KEGG   Rattus norvegicus (rat): 317312Help
Entry
317312            CDS       T01003                                 

Gene name
Mospd1
Definition
(RefSeq) motile sperm domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Motile_Sperm
Motif
Other DBs
NCBI-GeneID: 317312
NCBI-ProteinID: NP_001014129
RGD: 1359486
Ensembl: ENSRNOG00000002332
UniProt: Q5RJS6
Position
Xq37
AA seq 213 aa AA seqDB search
MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKY
VVIDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVIATLLPS
AKEQQKEEEEKRIKEHLTESVFFEQSCQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGD
MESLVPLYLHLSVNQKLVAAYILGLITMAILRT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaacaaaaaagacaaccagagttagtggaagggaatcttcctgtctttgtgttt
cccacggagctaatattttatgcagatgatcagtcaacacataagcaagtgttgactctg
tacaatccctatgagtttgccttaaagttcaaagttttgtgtacgactccaaataagtat
gttgtcattgatgctgctggtgcagtgaagccacagtgctgtgtggatattgtcattcgt
catagagatgttcgatcctgtcactatggtgtgatagacaaattccgtctccaggtttcg
gaacaaagccagaggaaagccttaggaaggaaagaggttattgctactcttctcccatct
gcgaaagaacaacaaaaggaagaagaggagaagagaataaaggagcacttaaccgagagt
gtattttttgagcagtcctgtcaaccagaaaacagagcagtctcttcaggacctagtttg
ctaactgtcttcctgggagtggtatgtattgcggccctgatgctgcctactctaggggat
atggaatcgctggtgcctctctacctccacttaagtgtgaatcaaaaattagtggctgct
tatatcttaggtcttatcacaatggctatacttagaacatga

DBGET integrated database retrieval system