KEGG   Rattus norvegicus (rat): 317322Help
Entry
317322            CDS       T01003                                 

Gene name
Gpc4
Definition
(RefSeq) glypican 4
  KO
K08110  glypican 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    317322 (Gpc4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    317322 (Gpc4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    317322 (Gpc4)
Proteoglycans [BR:rno00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   317322 (Gpc4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  317322 (Gpc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican DUF1910 DUF5082
Motif
Other DBs
NCBI-GeneID: 317322
NCBI-ProteinID: NP_001014130
RGD: 1359399
Ensembl: ENSRNOG00000002413
UniProt: Q642B0
Position
Xq36
AA seq 557 aa AA seqDB search
MARLGLLALLCTLAALSASLLAAEPKSKSCSEVRRLYVSKGFNKNDAPLYEINGDHLKIC
SQDYTCCSQEMEEKYSLQSKDDFQTVVSEQCNHLQAIFASRYKKFDEFFKELLENAEKSL
NDMFVKTYGHLYMQNSELFKDLFVELKRYYVAGNVNLEEMLNDFWARLLERMFRLVNSQY
HFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVARDVVNRVSVVNP
TAQCTQALLKMIYCSHCRGLVTVKPCYNYCSNIMRGCLANQGDLDLEWNNFIDAMLMVAE
RLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAGRISRSISESA
FSARFRPYHPEQRPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSTVCNDERMAAGNENE
DDCWNGKSKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYN
GNDVDFFDISDESSGEGSGSGCEYQQCPSEFEYNATDHSGKSANEKADSAGGAPAEAKPY
LLAALCILFLAVQGEWR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcacggttaggcttgctcgcgcttctctgcactctggcggcgctcagcgcctcgctg
ctggctgcggagcccaagtcgaaaagttgttcggaagtgcgacgtctctacgtgtccaaa
ggcttcaacaagaacgatgcccccctctatgagatcaatggtgaccatttgaagatctgt
tcccaggattatacatgctgttctcaagagatggaggagaagtacagtctgcaaagtaaa
gatgatttccaaactgtggtcagcgagcagtgcaaccatttgcaagccatctttgcatcc
cgttacaagaagtttgatgaatttttcaaagaacttcttgaaaatgcagagaaatccctg
aatgatatgttcgtgaagacatacggccacttatacatgcaaaattcagagctatttaaa
gatctgttcgtagagttgaagcgctactatgtggcgggaaacgtgaacctggaagaaatg
ttaaatgacttctgggctcgccttctggagcgcatgttccgcctggtgaactcccagtac
catttcacagatgagtacctggaatgtgtgagcaaatacactgagcagctgaagcctttt
ggagacgtccctcggaaactgaagctccaggttacccgtgcattcgttgcagccaggacc
ttcgctcaaggcttagcagttgcaagggatgtcgtgaacagagtctctgtggtgaatccc
acagctcagtgcacccaagcactgctgaagatgatctactgctctcactgccggggcctg
gtgactgtgaagccctgttacaactattgctcaaacatcatgagaggctgtttggccaac
caaggagaccttgatttagagtggaacaatttcatagatgccatgctgatggtggcagag
aggctggagggtcctttcaacattgagtccgttatggatcccatcgatgtgaagatttct
gatgctatcatgaacatgcaggataatagtgttcaggtgtctcagaaggttttccaaggc
tgtggacctccaaagcctctcccggctggacgaatttctcgttccatctctgaaagtgcc
ttcagtgctcgattcagaccttatcatccagagcaacgcccaactacagcagctggcact
agtttggaccgactggttactgatgtcaaagagaaactgaagcaagctaagaagttctgg
tcctctctcccaagcactgtctgcaatgatgagaggatggcagcaggaaatgagaatgag
gatgactgttggaacgggaagagcaaaagcaggtacctgtttgcagtgacaggaaacgga
ttagccaaccagggcaacaacccagaagtgcaggttgacaccagcaagccggacattctg
atccttcgtcaaatcatggcccttcgggttatgaccagtaaaatgaagaatgcttacaac
ggaaatgacgtggacttctttgatatcagcgatgagagtagtggagagggaagcggaagc
ggatgtgaatatcagcagtgcccttcagagtttgagtacaacgccactgaccattctggg
aagagtgccaacgagaaagctgacagtgccggtggtgcccctgcagaggcaaagccctat
ctcctcgctgccctctgcatcctgttcctcgctgtgcagggagagtggagataa

DBGET integrated database retrieval system