KEGG   Rattus norvegicus (rat): 317366
Entry
317366            CDS       T01003                                 

Gene name
Pim2
Definition
(RefSeq) serine/threonine-protein kinase pim-2
  KO
K08806  proto-oncogene serine/threonine-protein kinase Pim-2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05200  Pathways in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    317366 (Pim2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    317366 (Pim2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    317366 (Pim2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     317366 (Pim2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   317366 (Pim2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo TCAD9
Other DBs
NCBI-GeneID: 317366
NCBI-ProteinID: NP_001165574
Ensembl: ENSRNOG00000008177
UniProt: F1M419
Position
X
AA seq 311 aa
MLTKPLQGLPSPPVTPTQPPGGKDRAAFEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAI
KVISRNRVLGWSTVSDSVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPEGFMLVLERPM
PAQDLFDYITEKGPLGESCSRSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSVKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGVLLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEILLDPWMQTPAEEKPINPSKG
SPTPLPWSLGP
NT seq 936 nt   +upstreamnt  +downstreamnt
atgttgaccaagcctctgcaggggcttccttcgccccctgtgacccccacgcagcctcca
ggaggcaaggatcgggcagctttcgaggccgaataccgacttggccctctcctgggtaag
ggaggctttggcaccgtcttcgcgggacaccgcgtcacggatagacgtcaggtggccatc
aaagtaatctcccggaaccgtgtgctaggctggtccactgtgtcagactcagtcacctgc
ccacttgaggtggcactgctgtggaaggtgggtgaaggtaatggccatccgggtgtgatc
cgcctgcttgactggtttgagacaccagaaggcttcatgctggtccttgagcggcctatg
cctgcccaggatctcttcgactacatcacagagaagggtccgctgggtgaaagctgtagc
cgcagcttcttcacccaagtagtggcagctgtccagcactgccacgcccgtggcgttgtc
catcgtgacatcaaggatgagaacatcctgatagacctgtgccggggttctgttaaactc
attgatttcggttctggtgcgctgcttcatgatgaaccatacacggactttgatgggaca
agggtgtacagccctcccgagtggatctcgagacaccagtaccatgcccttccagctact
gtctggtcactgggtgtcctactctatgacatggtgtgtggggacattcccttcgagaga
gatcaggagattctggaggctgagcttcacttccctgctcacgtgtccccagattgctgt
gccctaatccgacggtgcctggcccctaaaccctgttcccgaccctcactggaggagata
ctgctggacccctggatgcaaacaccagctgaagaaaaacccatcaacccctccaaagga
agccccacccccttgccctggtctctgggtccctag

DBGET integrated database retrieval system