KEGG   Rattus norvegicus (rat): 317371
Entry
317371            CDS       T01003                                 

Gene name
Was
Definition
(RefSeq) wiskott-Aldrich syndrome protein
  KO
K05747  Wiskott-Aldrich syndrome protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04520  Adherens junction
rno04530  Tight junction
rno04666  Fc gamma R-mediated phagocytosis
rno05135  Yersinia infection
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    317371 (Was)
   04530 Tight junction
    317371 (Was)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    317371 (Was)
   04062 Chemokine signaling pathway
    317371 (Was)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    317371 (Was)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    317371 (Was)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    317371 (Was)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    317371 (Was)
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    317371 (Was)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    317371 (Was)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     317371 (Was)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EVH1 / WASP  homology  (WH) domain-containing proteins
  WH1 domain-containing proteins
   317371 (Was)
SSDB
Motif
Pfam: WH1 PBD
Other DBs
NCBI-GeneID: 317371
NCBI-ProteinID: NP_001101718
RGD: 1563567
Ensembl: ENSRNOG00000031058
UniProt: G3V9K5
Position
X
AA seq 355 aa
MSSGPVGGRSGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATAVVQLYLALPPG
AEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGD
DCQVGLNFSDESEAQAFRALVQEKIQKRNQRQSGERRQLPLTPAPTNEERRGGLPPVPPH
PGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPPPPPPCRGGGGNPWSYGELSTASTPSAVRRPSGCPDACHAEEE
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgagtagtggccctgtaggaggcaggtctgggggccgagggggaccagcagttcagcag
aacattccttccaacctcctccaggaccatgagaaccagagactcttcgagcttctcggc
cgaaaatgctggacactggcaactgcagttgttcagctgtacctggcactgccccctgga
gctgagcactggaccatggaacactgcggggctgtgtgcttcgtgaaggataaccctcag
aagtcgtacttcatccgcctttatggcctacaggctggtcgactactctgggaacaggag
ctatactcacagctggtttaccttactcctaccccattcttccacacctttgctggagat
gactgtcaagtaggactgaacttttcggatgagagtgaagcccaggccttccgggccttg
gtgcaggagaagatacaaaaaaggaatcagaggcaaagtggagaaagacgccagctacca
ctgacaccagcaccaaccaatgaggagagaagaggagggctcccacctgtgcccccacat
cccggtggagatcatgggggcccatcaggtggtccactatctctgggacttgtgacagtt
gacattcagaatcctgacatcacaagttcacgttaccgtgggctccctgcacctggccct
ggcccaactgataagaaacgctcaggaaaaaagaagatcagtaaagctgatattggtgca
ccaagtggattcaaacacgtcagccacgtgggctgggatccacagaacggatttgatgtg
aacaacctcgacccggatctgcgcagtttgttctctagggcagggatcagtgaggcccaa
ctcactgacgcagagacctccaagctcatctatgactttattgaggaccagggtggtcta
gaggcagtccggcaggagatgaggcgccaggagccaccaccaccaccaccatgccgagga
ggaggaggaaacccctggagctatggagaactcagtaccgcaagcactccctcagcagtc
agaaggcctagtgggtgccctgatgcatgtcatgcagaagaggagtaa

DBGET integrated database retrieval system