KEGG   Rattus norvegicus (rat): 317376
Entry
317376            CDS       T01003                                 

Gene name
Tfe3, RGD1559642, Tcfe3
Definition
(RefSeq) transcription factor binding to IGHM enhancer 3
  KO
K09105  transcription factor E3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno05202  Transcriptional misregulation in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    317376 (Tfe3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    317376 (Tfe3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    317376 (Tfe3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    317376 (Tfe3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    317376 (Tfe3)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH
Other DBs
NCBI-GeneID: 317376
NCBI-ProteinID: NP_001258156
RGD: 1559642
Ensembl: ENSRNOG00000009605
UniProt: D3ZAW6
Position
Xq12
AA seq 573 aa
MSHATETARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENILD
PDSFYELKSQPLSLRSSLPISLQATPTTPATLSASSSAGGSRTPAMSSSSSRVLLRQQLM
RAQAQEQERRERREQAAAAPFPSPAPASPAISVIGVSAGGHTLSRPPPAQVPREVLKVQT
HLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPSSAQPLPAPETAHATGPTG
SAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTAGLQLPSTLPVSGN
LLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRFN
INDRIKELGTLIPKSNDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQANR
SLQLRIQELELQAQIHGLPVPPNPGLLSLATSSVSDSLKPEQLDIEEEGRPSTTTFHVSG
GPTQNAPPQQPPAPPSDTLLDLHFPSDHLGDLGDPFHLGLEDILMEEEGMVGGLSGGALS
PLRAASDPLLSSVSPAVSKSSSRRSSFSMEDES
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgtctcatgcaactgagacagctcgggacggcgtagaggccagcgcggagggccctcga
gccgtgttcgtgctgttggaagagcgcaggccagctgactcggcccagctgctcagcctg
aattctttgcttccggaatccgggattgttgctgacatcgagttagaaaacatccttgat
cctgacagcttctacgagctcaaaagccagcctctatcccttcgctccagccttccaata
tcactgcaggccactccgaccaccccagctacactctctgcatcgtcttctgcagggggc
tcccggacccctgccatgtcatcctcctcctcacgggtcttgctgcggcagcagcttatg
agggcccaggcacaggaacaggagaggcgtgagcggcgggaacaggcagcggccgctccg
ttccccagtcctgcacctgcctcaccagccatctcagtgattggtgtgtctgctggtggc
cacacattgagtcgtccaccccctgctcaggtgcccagggaggtactcaaggttcaaacc
cacctagagaaccctacacgctaccacttgcagcaagctcgccggcaacaggtgaaacag
tacttgtctactacacttgggcccaagctggcttcacaggccctcaccccaccaccaggg
ccttccagtgctcagccacttcctgcccctgaaactgctcatgccaccggccctacaggc
agtgctcctaacagccccatggcattgctcaccattgggtccagctcagagaaggagatt
gatgatgtcattgatgagatcatcagcctggagtccagttacaacgatgagatgctcagc
tatcttcctggaggcactgcagggctgcagctccccagcacgctgcctgtgtcaggaaat
ctacttgatgtgtacagcagtcagggtgtggccaccccagccatcactgtcagcaattcc
tgtcctgctgagctgcctaacatcaaacgggagatctcggaaaccgaggcaaaggccctt
ttgaaggagcgacagaagaaagacaatcacaacctaattgaacgacgcaggcgattcaac
attaacgataggatcaaagagctgggcaccctcatccccaagtccaatgatccggagatg
cgctggaacaagggaaccatcctgaaggcatctgtggattatatccgcaaattacagaag
gaacagcagcgctctaaagacctggagagccggcagcggtccctggagcaagccaaccga
agcctgcagctccgaattcaggagctggaactacaggcacagatccatggtctgccggtc
cctcccaacccaggactgctctccctagccaccagctcggtctctgacagcctcaagccg
gaacaactggacattgaggaggagggcaggccaagcacaacaacatttcatgtgtcaggg
gggcctacccagaatgctcctccacaacagcctccggcaccgccttcggatacccttctg
gacctgcactttcccagcgaccacttgggggacctgggggaccccttccacctagggcta
gaggacattctgatggaggaggaggggatggtgggaggactgtcagggggtgccctgtcc
ccactgcgggctgcttccgaccccctgctttcttcagtatccccggctgtttccaagtcg
agcagccggcgcagcagcttcagcatggaagacgagtcctga

DBGET integrated database retrieval system