KEGG   Rattus norvegicus (rat): 317382Help
Entry
317382            CDS       T01003                                 

Gene name
Foxp3, RGD1562112
Definition
(RefSeq) forkhead box P3
  KO
K10163  forkhead box P3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04659  Th17 cell differentiation
rno05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    317382 (Foxp3)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    317382 (Foxp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    317382 (Foxp3)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    317382 (Foxp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead FOXP-CC
Motif
Other DBs
NCBI-GeneID: 317382
NCBI-ProteinID: NP_001101720
RGD: 1562112
Ensembl: ENSRNOG00000011702
UniProt: D3ZKI1
Position
Xq12
AA seq 429 aa AA seqDB search
MPNPRPAKPMAPSLAPGPSPGGLPSWKTAPKGSELLGTRGPGGPFQGRDLRSGAHTSSSS
LNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPHFMHQLSTVDAHGHTPVLQV
RPLDNPAMIGLPPPTAATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPRSGTPRKD
SNLLAAPQGSYPLLANGVCKWPGCEKAFEEPGEFLKHCQADHLLDEKGKAQCLLQREVVQ
SLEQQLELEKEKLGAMQAHLAGKMALTKAPPVASVDKSSCCLVATSTQGSVLPAWSSPRE
ASDSLFAVRRHLWGSHGNSTFPEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRTL
NEIYHWFTRMFAYFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFEFRKKRSQR
PSKCSNPCP
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacccaaggccagctaagcctatggctccttccttggcccctggcccgtcccca
ggaggcttgccaagctggaagactgcgcccaagggctcagaactcctagggaccaggggt
cctgggggacccttccaaggccgggacctgcgaagtggggcccacacctcctcttcttcc
ttgaaccccctgccaccatcacagctgcagctgcctacagtgcccctagtcatggtggca
ccctctggggcccgactaggcccctcaccgcacctgcaggcacttctccaggacagacca
cactttatgcatcagctctccactgtagacgcacatggccacacccctgtgctacaagtg
cgcccactggacaacccagcgatgatcggcctcccaccgcctactgctgccactggagtc
ttctccctcaaggcccggcctggcctgccacctgggatcaatgtggccagtctggaatgg
gtgtccagggagccggctctactctgcaccttcccacgctcaggtacacccaggaaagac
agcaaccttctggctgcaccacaaggatcctacccactgctggcaaacggagtctgcaag
tggccgggttgtgagaaggccttcgaggagccgggagagtttctcaagcactgccaagca
gatcacctcttggatgagaagggcaaggcccagtgcctcctccagagagaagtggtgcag
tctctggagcagcagctggagctggaaaaggagaagctgggagctatgcaggcccacctg
gctgggaagatggcattgacaaaagctccacctgtggcctcagtggacaagagctcctgc
tgcctcgtagccaccagcacccagggcagcgtcctcccggcctggtctagtccccgggaa
gcttcagacagcttgtttgctgtgcggagacacctctggggaagccatggaaacagcacc
tttccagagttcttccacaacatggactacttcaagtaccataatatgcggccccctttc
acctatgccaccctcatccgatgggccatcctggaagctccagagaggcagaggacactc
aatgaaatctaccattggttcacacgcatgttcgcctacttcagaaaccaccccgccacc
tggaagaatgccatccgccacaacctgagcctgcacaagtgctttgtgcgagtggagagt
gagaagggagcagtgtggaccgtagatgaatttgagtttcgcaagaagaggagccaacgc
cccagcaagtgctccaacccctgcccttga

DBGET integrated database retrieval system