KEGG   Rattus norvegicus (rat): 317385Help
Entry
317385            CDS       T01003                                 

Gene name
Fus
Definition
(RefSeq) fused in sarcoma RNA binding protein
  KO
K13098  RNA-binding protein FUS
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    317385 (Fus)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    317385 (Fus)
Spliceosome [BR:rno03041]
 Complex A
  Other components
   Complex A specific factors
    317385 (Fus)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RanBP RRM_1 Limkain-b1
Motif
Other DBs
NCBI-GeneID: 317385
NCBI-ProteinID: NP_001012137
RGD: 1308864
Ensembl: ENSRNOG00000023360
UniProt: Q5PQK2
Position
1q37
AA seq 518 aa AA seqDB search
MASNDYTQQATQSYGAYPTQPGQGYSQQSNQPYGQQSYSGYGQSADTSGYGQSSYGSSYG
QTQNTGYGTQSAPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGGSSQS
SSYGQPQSGGYGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSSSGGGGGGGGGNYGQ
DQSSMSGGGGGGGYGNQDQSGGGGGGYGGGQQDRGGRGRGGGGGYNRSSGGYEPRGRGGG
RGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQ
IGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVS
FATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWK
CPNPTCENMNFSWRSECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGRGGYDRGGYRGRG
GDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaacgactatacccaacaagcaactcaaagctatggggcctatcctacccag
cctgggcagggctattcccaacagagcaatcagccctatggccagcagagttacagtggt
tatggccaatcagctgacacttcaggatacggccagagcagctatggttcttcttatgga
cagacccaaaacacaggctatggaactcagtcagcaccccagggatatggttccactggt
ggctatggcagcagccaaagttcccagtcttcttatgggcagcagtcctcctaccccggt
tatggccaacagccagctcctagtagcacctcaggaagttatggtggaagttctcagagc
agcagctatgggcagccccagagtggaggctatggtcaacagtctggctatggtggacag
caacaaagctacggacagcaacaaagctcctataacccacctcagggttatggacaacag
aaccagtacaacagcagcagtggaggtggtggagggggtggtggaggcaactatggccaa
gatcagtcctctatgagtggcggcggcggtggtggtggttatggcaatcaggaccagagt
ggtggcggcggtggtggctacgggggaggccagcaggatcgtgggggccgtggcaggggc
ggtggaggtggttacaaccgaagcagtggtggctatgaacccagaggccgtggaggtggc
cgaggaggcagaggcggcatgggcggaagtgaccgtggtggcttcaataaatttggtggt
cctcgggatcaaggatctcgtcatgattctgaacaggataattcagacaataataccatc
ttcgtgcaaggcctaggcgagaatgttacaattgaatctgtggcggattacttcaagcag
attggaattattaagacaaacaagaaaactggacagcctatgattaatttgtatacagac
agagaaactggcaagttgaagggtgaggcaacagtctcatttgatgacccaccttctgct
aaagctgcaatcgactggtttgatggaaaagaattctctgggaatcctattaaagtttca
tttgctacccggcgtgctgacttcaaccggggtggtggaaatggtcgtggaggccgaggg
cgaggaggacccatgggccgtggaggctatggaggaggtggcagcggtggtggtggccgg
ggaggatttcccagtggaggtggtggaggtggaggacagcaacgagctggggactggaag
tgtcctaatcctacatgtgagaacatgaacttctcttggagaagtgaatgcaaccagtgt
aaggcacctaagccagatggcccaggagggggaccaggaggctctcatatggggggaaac
tacggagatgatcggcgtggcagaggaggatatgatcggggcggctaccggggccgagga
ggggaccgagggggcttcagagggggccggggtggtggggacagaggtggttttggccct
ggcaagatggactccaggggtgagcacagacaggatcgcagggagaggccatattag

DBGET integrated database retrieval system