KEGG   Rattus norvegicus (rat): 317385
Entry
317385            CDS       T01003                                 

Gene name
Fus
Definition
(RefSeq) RNA-binding protein FUS
  KO
K13098  RNA-binding protein FUS
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03040  Spliceosome
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    317385 (Fus)
  09122 Translation
   03013 RNA transport
    317385 (Fus)
   03015 mRNA surveillance pathway
    317385 (Fus)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    317385 (Fus)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    317385 (Fus)
   05022 Pathways of neurodegeneration - multiple diseases
    317385 (Fus)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    317385 (Fus)
Spliceosome [BR:rno03041]
 Complex A
  Other components
   Complex A specific factors
    317385 (Fus)
SSDB
Motif
Pfam: zf-RanBP RRM_1
Other DBs
NCBI-GeneID: 317385
NCBI-ProteinID: NP_001012137
RGD: 1308864
Ensembl: ENSRNOG00000023360
UniProt: Q5PQK2
Position
1
AA seq 518 aa
MASNDYTQQATQSYGAYPTQPGQGYSQQSNQPYGQQSYSGYGQSADTSGYGQSSYGSSYG
QTQNTGYGTQSAPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGGSSQS
SSYGQPQSGGYGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSSSGGGGGGGGGNYGQ
DQSSMSGGGGGGGYGNQDQSGGGGGGYGGGQQDRGGRGRGGGGGYNRSSGGYEPRGRGGG
RGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQ
IGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVS
FATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWK
CPNPTCENMNFSWRSECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGRGGYDRGGYRGRG
GDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggcttcaaacgactatacccaacaagcaactcaaagctatggggcctatcctacccag
cctgggcagggctattcccaacagagcaatcagccctatggccagcagagttacagtggt
tatggccaatcagctgacacttcaggatacggccagagcagctatggttcttcttatgga
cagacccaaaacacaggctatggaactcagtcagcaccccagggatatggttccactggt
ggctatggcagcagccaaagttcccagtcttcttatgggcagcagtcctcctaccccggt
tatggccaacagccagctcctagtagcacctcaggaagttatggtggaagttctcagagc
agcagctatgggcagccccagagtggaggctatggtcaacagtctggctatggtggacag
caacaaagctacggacagcaacaaagctcctataacccacctcagggttatggacaacag
aaccagtacaacagcagcagtggaggtggtggagggggtggtggaggcaactatggccaa
gatcagtcctctatgagtggcggcggcggtggtggtggttatggcaatcaggaccagagt
ggtggcggcggtggtggctacgggggaggccagcaggatcgtgggggccgtggcaggggc
ggtggaggtggttacaaccgaagcagtggtggctatgaacccagaggccgtggaggtggc
cgaggaggcagaggcggcatgggcggaagtgaccgtggtggcttcaataaatttggtggt
cctcgggatcaaggatctcgtcatgattctgaacaggataattcagacaataataccatc
ttcgtgcaaggcctaggcgagaatgttacaattgaatctgtggcggattacttcaagcag
attggaattattaagacaaacaagaaaactggacagcctatgattaatttgtatacagac
agagaaactggcaagttgaagggtgaggcaacagtctcatttgatgacccaccttctgct
aaagctgcaatcgactggtttgatggaaaagaattctctgggaatcctattaaagtttca
tttgctacccggcgtgctgacttcaaccggggtggtggaaatggtcgtggaggccgaggg
cgaggaggacccatgggccgtggaggctatggaggaggtggcagcggtggtggtggccgg
ggaggatttcccagtggaggtggtggaggtggaggacagcaacgagctggggactggaag
tgtcctaatcctacatgtgagaacatgaacttctcttggagaagtgaatgcaaccagtgt
aaggcacctaagccagatggcccaggagggggaccaggaggctctcatatggggggaaac
tacggagatgatcggcgtggcagaggaggatatgatcggggcggctaccggggccgagga
ggggaccgagggggcttcagagggggccggggtggtggggacagaggtggttttggccct
ggcaagatggactccaggggtgagcacagacaggatcgcagggagaggccatattag

DBGET integrated database retrieval system