KEGG   Rattus norvegicus (rat): 317420
Entry
317420            CDS       T01003                                 

Gene name
Wnk3, RGD1563131
Definition
(RefSeq) WNK lysine deficient protein kinase 3
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    317420 (Wnk3)
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    317420 (Wnk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     317420 (Wnk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  Wnk family
   317420 (Wnk3)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     317420 (Wnk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr OSR1_C
Other DBs
NCBI-GeneID: 317420
NCBI-ProteinID: NP_001157079
RGD: 1563131
Ensembl: ENSRNOG00000002537
UniProt: D4A7Z8
Position
Xq12
AA seq 1691 aa
MATDSGEPASTEDSEKPDGVSFQSRVARAVAPLTVEARIKEKYSTFSASGETIERKRFFR
KSVEMTEDDKVAQSSRRDERKVATNISRVEKVPTNVLRGGQEVKYEQCSKATSESSKDCF
KEKTEKEMEEEAEMKAVATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDR
KLTKAEQQRFKEEAEMLKGLQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLKR
FKVMKPKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLM
RTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKV
TSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIKDLLNHAFFAEDTGLRVELAEEDDC
SNSSLALRLWVEDPKKLKGKHKDNEAIEFSFNLEADTPEEVAYEMVKSGFFHESDSKAVA
KSIRDRVTLIKKIREKKPAGCLEERRDSQCKHARNVNPQQQTATLRPAPGPHNAAECEET
EVDQHVRQQLVQGKAQQQPSSVRGDTSSEPAAGPVLHSDTSSHPTVAYSSNQATSSQEQP
KLTRSPVLPVVQGQSSVMPIYAAGPAVASQSQISPLTIQKVSQIKPVSQPIGAEQQATPP
NPDFVRSLNQDVTSVKENTNSPDTPSGNGKQDRIKQRRASCPRPEKGTKFQLTVLQVSVS
GDNMVECQLETHNNKMVTFKFDVDGDAPEDIADYMTGSSEQVLINSASTQTSNESAPQSS
PVGRWRFCINQTIKNREAQSPPSLQPSVAMVPGLHPFPNNTSNQEISQDTLFTVPGHHVV
FTSKLDGKIGERASVETEQTSVPYQAEDDKLKAPATDTSNYSATLVCPDPAGCEALTSQA
GMFIPTYPCQQAAVPADVLMSHPGESVQIGSNAVVTSVLVSSDQKPQSLSVQQPTIDAEF
ISQEGETTVNSETSSPKAVGATQTPGFEPTVLLPATILESDGERPPKMEFTDNRIKTLDE
KLRNLLYQEHSISTICPESQKDTQSIDSPFSSSAEDILSSPMPEVIAISHCGIQDSQAQS
PNFQPTGSKILSNVAASQPAHIPVLKRDLNVITSVPSELCLHEMSPDASLPGDPEAYPAA
VSSDGTIHLQTGGGYFGLSFTCPSLKNPISRKSWTRKLKSWAYRLRQSTSFFKRSKVRQV
ETEDKRSAIASDPIPLTREFSADTRALSRCKAMSGSFQRGRFQVITVPQQQPVKMMSFGK
EHRPPSKKTTAQSNEQALTFTEAAVTQLIEVEPAIPTHKASVSSQKLRTLYETFKEDKGD
PEQGDILSLSTARETSVSSVTTEKNVEETSTTGISVQSGSEMLDKEKDESTPGKQTCTNE
FSATPAGSGKSVAKAAPKSGQHLPARAQTQSSLFYSPSSPMSSDNESEIEDEDLKAELQR
LREKHIQEVVSLQTQQNKELQELYERLRATKDSKAQSSEVPMPPASPRRPRSFKSKLRSR
PQSLTHSDNLVVVKDVQRAESNTAPRQQSPASKKGMFTDDLHKLVDDWTRETVGNFPSKP
SLNQLKQSQQKSEAENWNKLHESTPSTVGYTSTWISSLSQIRGAAPSSLPHGLPLPSFPG
PLASYGMPHACQYNPVGAASYPVQWVGISGAAQQSVVLPTQSGGLFQPGMNLQSFPAPPV
QNPPSIPPGPK
NT seq 5076 nt   +upstreamnt  +downstreamnt
atggccactgattctggggagccagctagcacagaagattctgagaagcctgatggagtt
tcctttcaaagcagggttgcccgggctgttgcacctctgactgtagaagctagaataaag
gaaaaatacagtaccttttctgcttctggggaaaccattgaaagaaagagatttttccga
aagagtgttgagatgacagaagatgacaaagttgcccaatcttcccgcagagatgaaaga
aaagttgcaacaaatatttcaagagtagaaaaagttcctacaaatgtgctaagaggtggg
caagaagttaaatatgagcagtgttcaaaggcaacctcagaatcctcaaaagattgcttc
aaggagaaaactgaaaaggaaatggaagaagaagcagaaatgaaggctgtcgcaacgtcc
cctagtggcaggtttctaaaatttgatatagagctgggaagaggcgcttttaaaacagta
tataaaggattggacactgaaacatgggttgaagttgcttggtgtgagctacaggaccgc
aaattaactaaagctgagcagcaacggttcaaagaagaagctgagatgttgaaaggcctc
cagcatcccaatatagttcgattttacgattcatgggagtccatattgaaaggaaagaaa
tgtattgttttagtgactgaactaatgacatcaggaaccttaaagacgtacttaaaacga
tttaaagtcatgaaaccaaaggtcttaagaagctggtgcaggcaaattttaaaaggattg
cagttcttacacacaaggacgcctcctattattcaccgggatctgaaatgtgacaacatt
ttcatcacaggacccactggatctgtgaagattggtgatctgggacttgcaaccttaatg
cgcacatcctttgctaagagtgtcattggcactcctgagtttatggcgccagagatgtat
gaagaacactatgatgaatctgtagatgtttatgcttttgggatgtgtatgttggaaatg
gctacttcggagtatccatattctgagtgccagaatgcagcacaaatataccgtaaagta
accagtggcataaaaccagccagcttcaataaagtcacagaccctgaagtgaaagaaata
attgaaggatgtattagacaaaacaaatctgaaaggttatcgatcaaggatctactaaac
catgcattctttgctgaggatactggactgagggtggagttagcagaggaagatgattgc
tcaaattcatccttggctctaagactctgggttgaagatcctaagaaattaaaaggcaaa
cataaagacaatgaagctattgaattcagtttcaacttagaagcagatacacctgaggaa
gtagcgtatgaaatggtcaagtctggattcttccatgaaagtgattccaaagctgttgct
aagtccattagggaccgtgtgacactgattaaaaagataagggaaaagaagcctgctgga
tgcttagaggaacgcagggattcccagtgcaagcatgcgaggaatgtaaatcctcagcag
cagactgcaactttacgacctgctcctggtccacacaatgcggctgagtgtgaagaaaca
gaagttgatcaacatgttcgacagcagcttgtacaaggcaaagcacagcagcagccctcc
tctgttaggggtgacacttcatctgaaccagcagctggaccagttctacattcagatact
tcaagtcaccccactgtagcctattcttcaaaccaggcaactagttctcaggagcagcca
aagctgactcggtctccagttttgcctgtggttcaaggtcagtcttctgttatgcccata
tatgctgctggacctgcagttgcttcacagtcccagatttctccattaactatccagaag
gtctcacagataaagcctgtatcccaaccaattggagctgaacaacaagcaactcctcca
aatccagattttgttcgaagcttgaatcaagatgtgacatctgtgaaagaaaacaccaat
agccctgataccccaagtggaaatggcaaacaggatcggatcaaacaaagaagagcctcc
tgtccccgaccagagaaggggactaaattccagcttactgtccttcaggtctcagtctct
ggggacaacatggtggaatgtcagctggaaacacataacaacaagatggtcacattcaag
tttgatgttgatggtgatgcacctgaggatatcgctgactatatgacaggatcatctgaa
caagtattgataaattctgcatccactcaaactagcaatgaatctgctcctcagtcatcc
ccagttggtcgctggcggttttgtatcaaccaaacaataaaaaatcgtgaggcgcagtct
cctccttcccttcagccttccgtggctatggtgcctgggttacatccatttcctaataac
acaagtaatcaagaaatatcacaggacacactgttcactgttccaggccatcatgtagtt
ttcacctccaagttagatggtaagattggtgaacgtgctagtgtagaaacggagcagacg
agtgttccctatcaagcagaagatgacaaactaaaggcaccagctactgatacttccaat
tattctgctactttggtgtgtccagatccagctggatgtgaggcactcaccagccaagca
ggcatgttcatacctacatatccatgtcagcaagctgctgttccggctgatgtgcttatg
tcccatcctggtgaatcagttcagattggcagtaatgctgttgtaacgtcagtacttgta
tcttctgatcaaaagcctcaatccttatcagtacagcagccaactatagatgcagagttt
atttcacaagaaggagaaaccacagtaaactctgaaacgagttctcctaaggctgtcggt
gccactcagactcctggctttgaaccaactgtgcttctacctgcgactatcctggaatca
gatggggaacgacctccaaaaatggagtttacagacaatcgaattaaaacactggatgaa
aaattaagaaacctgctctatcaagagcacagcatttctaccatctgtcctgagagtcag
aaggatactcaaagcatagactctccattttcttcctctgctgaagatatactatcctcc
ccaatgccagaagtcatagccatcagtcactgtgggattcaagatagccaagcacaatcc
ccgaatttccaaccaacaggctctaagattctatcgaatgtggctgcaagtcagcctgct
catataccagtgctcaaaagagacctgaatgtgataacttctgtacccagcgagctatgt
ttacacgagatgtccccagatgcttcacttccaggggatccagaggcctatcctgctgct
gtgtcaagcgatggaaccattcatctgcagacaggaggtggatattttggcctaagcttt
acttgtcctagtctcaaaaatcctattagcaggaaatcctggactcgaaaattaaaaagc
tgggcatacaggctacggcagtcaaccagctttttcaagagatcaaaagttcgtcaagtg
gaaacagaagataaaagatcagcaattgcttctgatcccattccgctgacacgggagttc
tcagctgatactagggctttgagtagatgtaaagcgatgagtggatcatttcagcggggt
cggttccaggtgattacagttcctcagcagcagccagtgaaaatgatgtcttttggaaaa
gaacatagaccgccatcgaagaaaacgacagcccagtctaacgagcaagcactaaccttt
actgaagctgcagtgacacagttgatcgaagtggaacctgccatacccactcataaagct
tcagtttcttcacaaaagttacgaactctttatgaaacctttaaagaagataaaggagac
cctgaacaaggtgacatcttatctttgagcacagctcgtgagaccagtgtgtcttcagtg
acaacagaaaagaatgtggaagaaacttctactacaggaattagtgtgcagtctgggtct
gaaatgttagataaagaaaaagatgaatcaactcctgggaaacagacatgtactaatgaa
ttttcagccactcctgctggcagtggaaagtcagtggcaaaagctgctccaaagagtggt
cagcatttaccagcccgtgctcaaacacagagttcactcttctactctccatcttctcca
atgagcagtgacaatgaatcagaaatcgaggatgaggacttgaaagcggagcttcaaaga
ttacgggaaaaacacattcaagaggtggtcagtcttcaaacacagcagaataaagagcta
caggagctctatgaacgccttcgagcaactaaagacagcaaagcgcaatcttcagaagtt
cccatgccacctgcatcaccacgcaggccaagatccttcaaaagcaaacttcgaagccgc
ccccagtccttgacacattcggacaatctcgttgttgtaaaagatgtgcagcgtgcggag
agtaatactgcgccacgccagcaatcgccagccagtaagaaggggatgttcacagatgat
ttacacaagctggtggatgactggacaagagaaacagtaggaaattttcctagcaagcca
agtttaaaccaactcaaacagagccaacaaaaatcagaggcagaaaactggaacaagttg
catgaaagcactccatctactgtgggatacacatcaacctggatttcttctctctcccaa
attcgcggagctgccccgtcttccttgccacatggactcccactcccttcatttcctggg
ccattagcgtcctatggaatgcctcatgcttgtcagtacaatcccgtaggcgccgcaagc
tatccagtacagtgggttgggatttcgggagcagcacagcaatccgtagtgcttcctacc
caatctgggggactcttccagcctgggatgaatctgcagtcatttccagctccaccagtg
cagaacccaccttcaatccctcctggtcccaaatga

DBGET integrated database retrieval system