KEGG   Rattus norvegicus (rat): 317546
Entry
317546            CDS       T01003                                 

Gene name
Tab3
Definition
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 isoform X1
  KO
K12793  TAK1-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    317546 (Tab3)
   04668 TNF signaling pathway
    317546 (Tab3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    317546 (Tab3)
   04657 IL-17 signaling pathway
    317546 (Tab3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    317546 (Tab3)
SSDB
Motif
Pfam: zf-RanBP
Other DBs
NCBI-GeneID: 317546
NCBI-ProteinID: XP_038956492
RGD: 1594527
Ensembl: ENSRNOG00000003643
Position
X
AA seq 725 aa
MMDVTANVVNPRVAQHFKLLSCNNCKMSPGFGMRKLGVESQCSLNNNNLEACCRALSQES
SKYLYMEYHSPEDNRMNRNRLLHINLGIHSPSSYHPGDGAHLNGGRTLVHSSSDGHIDPQ
HTAGKQLICLVQEPHSAPAVVAATPNYNPFFMNEQTRSAATPPSQPPQQPSAMQTGMNPS
AMQGPSPPPPPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIY
IRPTSQSSSGRQTPQNAPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSV
YHSPPPSQCPSPFSSPQHQVQPPQLGHPSSHVFMPPSPSTTPPHLYQQGPPSYQKPGSHS
VAYLPYAASSLPKGSMKKIEITVEPSQRPGTAITRSPSPISNQPSPRNQHSLYTATTPPS
SSPSRGISSQPKPPFSVNPVYITYTQPTGPSCAPSPSPRVIPNPTTVFKITVGRATTENL
LNLVDQEERSAAPEPIQPISVIPGSGGEKGNHKYQRSSSSGSDDYAYTQALLLHQRARME
RLAKQLKLEKEELERLKAEVNSMEHDLMQRRLRRVSCTTTTPTPEEMTRLRSMNRQLQIN
VDCTLKEVDLLQSRGNFDPKAMNNFYDHIEPGPVVPPKPSKKDSSDSCAIERKARRISVT
SKAPADIHESQAAATEEHLSGCRQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCE
MPRYT
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgatggatgttacagcaaatgtggtgaatccaagagtagcacaacattttaagttgttg
agctgcaacaactgtaaaatgagtcctggatttggaatgagaaaacttggggttgagtca
caatgttcattaaataacaacaatctagaagcctgttgtcgagccctttcccaggagagc
agcaaatacttgtatatggaataccatagtccagaagacaatagaatgaatagaaatcgc
cttttgcatattaatctgggtatccattctcctagtagctaccacccaggagatggagct
caccttaatggtggtcgaacactggtacatagctcaagtgatggacatattgatcctcag
catacagcaggtaaacagctgatatgtttagttcaggaaccacactcagctccagctgtt
gtggctgctacacccaactataatccattttttatgaatgaacagaccagaagtgcagct
actccgccttcacagccacctcagcagccatctgccatgcaaacaggaatgaatccatcc
gctatgcaaggtccttcaccaccaccaccaccatcctacatgcacatacctcgctatagt
acaaatccaattactgttacagtatcccagaaccttccttctggacagactgtaccaaga
gctttacagattcttccacaaattccaagcaatctctatggatctcctggttctatttat
attagaccgacatctcagagttcatcaggaagacagactcctcagaatgctccatggcag
tcctcaccacaaggcccagtgcctcattacagccagcgtcctttacctgtttatccacat
caacagaactatcaaccttctcagtattctcccaaacaacagcagattcctcagtcagtt
taccattcaccgcctccttctcagtgtccttccccctttagctctccacagcatcaagta
caaccaccccagctgggccacccaagttctcatgtgttcatgccacctagtccttcaact
actccaccccacctatatcaacaaggacctcctagttatcagaaaccaggaagtcattca
gtagcctatctcccttatgcagcatctagcttacccaaaggttccatgaagaagatagaa
attacagttgaaccttctcaaagacctgggacagcaataactagaagtccgtcacccatc
agtaatcaaccatctccaaggaaccagcactcactgtatacagccaccacgccaccttca
agttctccttcaagagggatatctagtcaaccaaaacctccatttagtgttaatcctgtg
tatattacatatacacagccaactggaccttcatgtgctccatcaccatctcctcgggtg
ataccaaacccaactacagtttttaaaattactgtaggccgagcaacaactgaaaacctt
ttgaatttagtggaccaagaagaacgctctgcagcaccagaacctattcagcctatttca
gtgataccaggctctgggggagaaaagggaaaccacaagtatcaaaggagttctagttct
ggatcagacgactatgcctatacacaagccttgctgttacatcagcgagcaagaatggag
aggttagcaaagcagttgaaacttgaaaaagaggagctagagcgcttgaaagctgaagtt
aacagtatggagcatgacctgatgcagaggcggcttaggagagtcagctgcaccactaca
acgcccacgcctgaggaaatgacaagattgagaagcatgaacagacaactccagataaat
gttgactgtacactgaaagaagttgacctccttcaatctagaggaaactttgatccaaaa
gccatgaataatttttatgaccacatagaacctggcccagttgtaccaccgaagccatct
aaaaaagactcatcagactcctgtgcaattgagagaaaagcccgaagaattagtgtgact
tccaaagcaccggcagatatccatgaatcccaggctgcagctacagaagaacatttaagt
ggctgcaggcagagtcctcggacacaaccccgagatgaggattatgaaggggctccatgg
aattgtgacagctgtacctttctcaaccaccctgcactgaatcgctgtgagcagtgtgag
atgccacggtacacttga

DBGET integrated database retrieval system