KEGG   Rattus norvegicus (rat): 317599Help
Entry
317599            CDS       T01003                                 

Gene name
Atp11c, Atp11c-ps1, RGD1564481
Definition
(RefSeq) ATPase phospholipid transporting 11C
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    317599 (Atp11c)
Enzymes [BR:rno01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     317599 (Atp11c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase E1-E2_ATPase Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 317599
NCBI-ProteinID: XP_006227628
RGD: 1564481
Ensembl: ENSRNOG00000003472
UniProt: D3ZFC5
Position
Xq36
AA seq 1130 aa AA seqDB search
MASSFSNTSECAGEEKRVGTRTVFVGNHPISGTEAYIAQRFCDNRIVSSKYTLWNFLPKN
LFEQFRRIANFYFLIIFLVQVTVDTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHRADNE
VNKSTVYIIENAKRVRKESEKIKVGDVVEVQADETFPCDLILLSSCTTDGTCYVTTASLD
GESNCKTHYAVRDTIELCTAESIDNLRAAIECEQPQPDLYKFVGRISIYSNSIEAVARSL
GPENLLLKGATLKNTKKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLFIL
LTKAAVCTTLKYVWQSTPYNDEPWYNQKTQKERETFKVLKMFTDFLSFMVLFNFIIPVSM
YVTVEMQKFLGSFFISWDKDFFDEEINEGALVNTSDLNEELGQVDYVFTDKTGTLTENSM
EFIECCIDGHKYKGTTQEVDGLSQIDGPLAYFDKADKNREELFLRALCLCHTVEIKTNDA
VDGPIEGAQFTYISSSPDEIALVKGAQKFGFTFLGNWNGHIRVENQRKEIEEYELLHTLN
FDSVRRRMSVIVRTQGGDILLFCKGADSSIFPRVHSHEIDLTKVHVERNAMDGYRTLCVA
FKEIPPDDFERINVQLIEAKMALQDREEKLEKIFDVIETNMNLIGATAVEDKLQDQAAET
IEALHAAGLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLHELL
IEYRKKLLHEFPKSTRSLKKAWTEHQEYGLIIDGSTLSLILNSSQDCSSNNYKSIFLQIC
MKCTAVLCCRMAPLQKAQIVRMVKNLKGSPITLSIGDGANDVSMILESHVGIGIKGKEGR
QAARNSDYSVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLCFILPQFLYQFFCGFSQ
QPLYDAAYLTMYNICFTSLPILAYSLLEQHINIDALTADPRLYMKITGNAMLQLGPFLYW
TFLAAFEGTVFFFGTYFLFQTTSLEDNGKIYGNWTFGTIVFTVLVFTVTLKLALDTRFWT
WINHFVIWGSLAFYVFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSTWLAIILLIFISLF
PEILLIVVKNVRRRSARRNLSCRRASDSLSARPSVRPLLLRTFSDESNIL
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atggcctcatctttttctaacacctctgagtgtgctggagaagagaaacgagttggtaca
cgcacagtatttgttggcaatcatcccatttcaggaacagaagcttacattgcacagaga
ttttgtgataatagaatagtctcatctaagtatacactttggaatttcctaccaaagaat
ttgtttgaacagtttagaagaattgcgaatttttattttctcatcattttccttgtacag
gtcacagtagacacaccaaccagcccagttaccagtggacttccacttttcttcgttata
actgttacagcaatcaagcagggatatgaagattggcttagacacagagctgataatgaa
gttaacaaaagtactgtttatattattgaaaatgcaaaacgagtaagaaaagaaagcgaa
aaaatcaaggttggtgatgtagtagaagtacaggcagatgaaacctttccctgtgatctt
attcttctgtcatcctgcacaactgatggaacctgttatgtcactacagccagtcttgat
ggcgaatccaattgcaagacacattatgcagtgcgagataccattgaattgtgtacagcc
gaatccattgataatctccgagcagccattgaatgtgagcagccgcaacctgacctctac
aagtttgttgggcgaatcagtatctatagtaatagtattgaggctgttgccaggtctttg
ggacctgaaaatcttttgctgaaaggagccacacttaaaaataccaagaagatatatgga
gttgctgtttacactgggatggaaaccaaaatggctttgaattaccaagggaaatctcag
aaacgttctgctgttgaaaaatctattaatgccttcttgattgtttatttatttatctta
ctgaccaaagctgcagtatgcacaactctaaagtatgtttggcaaagtaccccctacaat
gatgagccttggtataaccaaaagactcagaaggaacgggaaacttttaaggttttgaaa
atgttcactgactttttatcattcatggttctcttcaacttcattatacctgtctccatg
tatgtcacagtagaaatgcagaaatttttagggtcattctttatttcatgggacaaagac
ttttttgatgaagaaattaatgaaggagccttggttaacacatcagaccttaatgaagaa
cttggtcaggtggactatgtatttacagataagactggaacactcactgaaaatagcatg
gaattcattgaatgctgcatagatgggcacaagtataaaggcacaactcaggaagttgat
ggattatctcagattgatgggcccttagcctattttgataaagcagataagaaccgggag
gagctctttctccgtgccctgtgcttatgtcacactgtagaaattaaaacaaatgatgca
gtggatggacctatagaaggagcacagttcacgtatatctcttcctcaccagatgaaata
gctttggtgaaaggagctcaaaagtttgggttcacatttttgggaaattggaatggacat
atcagagtagagaaccaaagaaaagaaatagaagagtatgaacttctccacaccttaaat
tttgattctgtccgccgacgtatgagtgtaattgtaaggacccaaggaggagatatacta
cttttctgtaaaggagcagattcatccatttttcccagggtgcatagccatgaaattgat
ttaaccaaggtccatgtggagcgtaatgcaatggatgggtatcggactctttgtgtagcc
ttcaaagaaattcccccagatgattttgaaagaatcaatgtacaactgatagaggctaaa
atggccctacaagatagagaagaaaaactggagaagatttttgatgtgattgagactaac
atgaatttaattggagccaccgctgtggaagacaagctacaagatcaggctgcagagacc
attgaagctctccatgcagctggcttaaaagtctgggtgcttactggggacaagatggaa
actgccaagtctacttgttatgcctgccgccttttccaaaccaatactgagctcttggaa
ctgactacaaaaaccattgaagaaagcgaaaggaaggaagatcgattgcatgaactgtta
atagaatatcgtaagaaattgctacatgagtttcctaaaagcactagaagccttaaaaaa
gcatggacagaacatcaggaatatggattaatcattgatggctccacattgtcacttata
ctaaattctagtcaagattgtagttcaaacaactataaaagcatttttctacaaatctgt
atgaaatgcactgcagtgctctgctgccggatggcaccattacaaaaagcccagattgtg
agaatggtgaagaacttgaaaggcagccccataacactgtcaataggtgatggtgccaat
gatgtcagtatgattttggaatcccatgtgggaataggtattaaaggaaaagaaggtcgt
caagcagccaggaatagtgattattctgttccaaagtttaaacatttaaagaaactgcta
ttggctcatggacatctatactatgtgagaatagcacatcttgtacaatatttcttctac
aagaacctttgtttcattttgccacagtttttgtaccaattcttctgtggattctcacaa
cagccactctatgatgctgcttatcttacaatgtataatatctgtttcacatccctgccc
atcctggcttacagtctactggaacagcacatcaacattgatgctctgactgcagaccct
cgattgtatatgaaaattactggcaatgctatgttacagttggggcccttcttatattgg
acatttctggctgcatttgaagggacagtgttcttctttgggacttatttcctttttcag
actacatccttagaagacaatggaaagatttatggaaattggacatttggaaccattgtt
tttacagtcttagtattcactgtaactctgaagctcgccttggatacccgattctggaca
tggataaatcattttgtgatttggggttctctggccttttatgtttttttctcattcttc
tggggaggaattatttggccttttctgaaacaacagagaatgtattttgtgtttgctcaa
atgctctcttctgtatctacatggttggctataattcttttaatatttatcagccttttc
cccgagattctcctaatagtagtaaagaatgtgcgaagaaggagtgccaggagaaatctg
agctgtagaagggcatctgactcattatccgccagaccttcagtcagacctcttctttta
cgaacattctcagacgaatctaatatattgtaa

DBGET integrated database retrieval system