KEGG   Rattus norvegicus (rat): 317612Help
Entry
317612            CDS       T01003                                 

Gene name
Htatsf1, RGD1563377
Definition
(RefSeq) HIV-1 Tat specific factor 1
  KO
K13093  HIV Tat-specific factor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    317612 (Htatsf1)
Spliceosome [BR:rno03041]
 Complex A
  Other components
   Complex A specific factors
    317612 (Htatsf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7
Motif
Other DBs
NCBI-GeneID: 317612
NCBI-ProteinID: NP_001101729
RGD: 1563377
Ensembl: ENSRNOG00000027761
UniProt: D4A997
Position
Xq37
AA seq 776 aa AA seqDB search
MSGSNLSGNDEFDEQLRMQELYGDPKEGDTQNEPSGETDSLGQPPDDTPYEWDLDKKAWF
PKITEDFIASYQANYGFSGDGAPSSTGNVQDANTKTVEEPPQKEIPETTDSKKRGEKRKA
ESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDDQGNL
KGDGLCCYLKKESVELALKLLDEDEIRGYKLHVEVAQFQLKGEYDASKKKKKCKDYKKKL
SLQQKQLDWRPERRAGPNRLRHERVVILKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQ
IRKLLLFDRHPDGVASVSFREPEEADNCIQTLDGRWFGGRQITAQAWDGTTDYQVEETSR
EREERLRGWEAFLNAPEANRGLQRMDSICGSERPGPSRVRHFSEHPSMSNMGAQEATTGM
AFEETIDENKFEKAEDDGGESEGDASEKDAKEGESDGDYPERESDEGCSKRQCEEGCPDR
ESGEGCSKRESGEGCPERELELEEGNPKKESQENGPERESKKKGKENYEKNGLAKESEDN
DLNRESEGEDSPKKESEEDDSERESEEDSSEKQSENGSDKELEENGVKKDFDQDASDKEF
PENVEKESEENETDKSEFDEGSERVLGEEGSEREFEEDSDEKEEEEDDDEEKEVVYERVF
EDDSDDFEEEEEAYEKECEDADEKEEDDDVDEKVFDDSDEKEDEEDTDVRKDDDASDKVF
EDNSNEKLFNEEEGPNEKLFDDSDERGTVGNVKEDGSQSTDSSFALSSSDDDGDEV
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcagcaacttgagcgggaacgatgaatttgatgagcagttgcgaatgcaagaa
ttgtacggagaccccaaggaaggtgacacccagaatgagccctctggagaaactgattct
ttgggacaaccaccagatgacactccctacgagtgggaccttgataagaaggcttggttc
cctaagatcaccgaagatttcattgcttcgtatcaggccaactacggcttttctggtgat
ggtgcacccagctctactgggaatgtccaggacgccaacactaagactgtagaagagccg
ccacagaaagaaatcccggaaaccactgactccaaaaagaggggagaaaagagaaaggct
gaatctggatggttccatgttgaagaagacagaaatacaaatgtatatgtgtcaggtctc
cctccagacatcacagtggatgaatttatacagcttatgtccaaatttggtattattatg
agggatcctcagactgaagaatttaaggtcaaactttacaaagatgatcaaggaaatctt
aaaggagatggactttgctgttatctaaagaaagaatctgtggaacttgcattaaaactt
ttggatgaagatgaaattagaggctacaaattgcatgtggaggtggcacagttccagctg
aagggggaatacgatgcctcaaagaagaagaagaagtgcaaagactataagaagaagctg
tctctgcagcagaagcagttggattggagacctgagagacgagctgggccaaaccggctg
cgccatgaacgagttgtcattctcaaaaatatgtttcaccccatggattttgaggatgat
ccattggtgctgaatgaaatcagagaggatcttcgagtagaatgttcaaagtttgggcag
attaggaagctccttctgtttgatagacacccagatggtgtggcctctgtgtccttcaga
gaaccagaggaggctgataattgtattcagactctggatggaaggtggtttggtggccgt
cagatcactgctcaagcctgggatgggactacagattatcaggtggaggagacctcaaga
gaaagagaggaaaggctaagaggctgggaggcattcctcaatgctcctgaggccaacaga
ggccttcagcgtatggattccatctgcggttcagaaaggccagggccttccagagtgagg
catttttcagagcacccaagtatgtctaacatgggtgctcaggaagctacgactggaatg
gcgtttgaagaaactatcgatgaaaataagtttgaaaaggcagaagatgatgggggagag
tctgaaggagatgcttctgaaaaagatgctaaagaaggtgagtccgatggagactaccct
gagagagagagtgatgaaggctgctccaagagacagtgtgaagagggctgccctgataga
gagagtggagaaggctgctccaagagagagagtggagaaggctgtcctgagagggagctt
gagctagaagagggtaatcctaaaaaggagtctcaggagaatggccctgaaagagaatct
aagaagaaaggtaaagagaattatgaaaagaatggccttgcaaaagaatctgaagacaat
gacctcaacagagagtccgaaggggaagatagccccaagaaagaatcagaagaggatgac
tcagagagggaatctgaggaagacagctcagaaaagcaatctgaaaatggctctgacaaa
gaactagaagaaaatggtgtgaaaaaagattttgaccaggatgcctctgacaaggagttc
ccagaaaatgttgagaaagagtcagaagaaaatgagactgacaagtcagaatttgatgaa
ggctctgaaagagtgttaggtgaggaaggctctgagagagaatttgaggaagactcagat
gaaaaggaggaggaggaagatgatgatgaagagaaagaggtcgtatatgaaagagttttt
gaggatgattctgatgacttcgaggaggaagaagaagcatatgaaaaggagtgtgaagat
gctgatgagaaagaggaagacgatgatgttgatgaaaaggtctttgatgactcggatgag
aaggaggatgaagaagacacagatgtaaggaaagatgacgatgctagtgacaaggtattc
gaagacaattccaatgagaagttgtttaatgaggaagaaggtcccaatgagaagttgttt
gatgattctgatgaaagagggactgtggggaatgtgaaggaagatgggtctcaatccaca
gacagcagctttgccctcagtagtagtgatgatgatggtgatgaagtgtaa

DBGET integrated database retrieval system