KEGG   Rattus norvegicus (rat): 317646Help
Entry
317646            CDS       T01003                                 

Gene name
Rpl13a
Definition
(RefSeq) ribosomal protein L13A
  KO
K02872  large subunit ribosomal protein L13Ae
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    317646 (Rpl13a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    317646 (Rpl13a)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    317646 (Rpl13a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L13
Motif
Other DBs
NCBI-GeneID: 317646
NCBI-ProteinID: NP_775462
RGD: 628697
Ensembl: ENSRNOG00000020618
UniProt: Q5RK10
Position
1q22
AA seq 203 aa AA seqDB search
MAEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRK
RMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVV
PAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLLRLRKQ
AEKNVEKKICKFTEVLKTNGLLV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggggcaggttctagtattggatggccggggccatcttctgggccgcctggcg
gccattgtggccaagcaggtactgctgggccgaaaggtggtggttgtacgctgtgagggc
atcaacatttctggaaatttctacagaaacaagttaaagtatctggcctttctccgaaag
cggatgaacaccaacccgtctcgaggcccctaccacttccgagccccaagccgcattttt
tggcgcactgtgcgaggcatgctgccgcacaagaccaaaagaggccaggctgccctggaa
cgcctcaaggtgttggatgggatccctccaccctatgacaagaaaaagcggatggtggtc
cctgctgccctcaaggttgtgcggctgaagcctaccagaaagtttgcttacctggggcgt
ctggctcatgaggtcgggtggaagtaccaggcagtgacagctactctggaggagaaacgg
aaggaaaaggcaaagatccattaccggaagaagaagcagctcttgaggctaaggaaacag
gcagaaaagaatgtggagaagaaaatctgcaagttcacagaggtcctcaagaccaatgga
ctcttggtgtga

DBGET integrated database retrieval system