KEGG   Rattus norvegicus (rat): 317673Help
Entry
317673            CDS       T01003                                 

Gene name
Bbc3, Puma
Definition
(RefSeq) Bcl-2 binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04390  Hippo signaling pathway
rno05016  Huntington disease
rno05162  Measles
rno05200  Pathways in cancer
rno05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    317673 (Bbc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    317673 (Bbc3)
   04215 Apoptosis - multiple species
    317673 (Bbc3)
   04115 p53 signaling pathway
    317673 (Bbc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    317673 (Bbc3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    317673 (Bbc3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    317673 (Bbc3)
  09172 Infectious disease: viral
   05162 Measles
    317673 (Bbc3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    317673 (Bbc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PUMA
Motif
Other DBs
NCBI-GeneID: 317673
NCBI-ProteinID: NP_776209
RGD: 631434
UniProt: Q80ZG6
Position
1q21
AA seq 193 aa AA seqDB search
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGLCEPGLPAAPAAPALLPAAYLC
APTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPT
QAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLP
LPRDPGAPEMEPN
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgcacgccaggagggcagctctccggagcccgtagagggcctagcccgcgac
agcccgcgtcctttcccgctcggccgcctgatgccctccgctgtatcctgcggcctctgc
gagcccggcctgcccgctgcccctgctgcccctgccttgctgccggccgcctacctctgc
gcccccaccgccccgcctgccgtcaccgccgccctggggggcccccgctggcctgggggt
caccgcagccggccccgaggcccgcgcccggacggtcctcagccctcgctgtcaccagcc
cagcagcacctagagtcgcccgtgcccagcgccccggaggccctggcgggaggccccacc
caagctgccccgggagtgcgtgtggaggaggaggagtgggcccgggagatcggggcccag
ctgcggaggatggcggacgacctcaacgcgcagtacgagcggcggagacaagaagagcaa
catcgacaccgaccctcgccctggagggtcatgtataatctcttcatgggactcctcccc
ttacccagggatcctggagccccagaaatggagcccaactag

DBGET integrated database retrieval system