KEGG   Rattus norvegicus (rat): 317674Help
Entry
317674            CDS       T01003                                 

Gene name
Fzd5
Definition
(RefSeq) frizzled class receptor 5
  KO
K02375  frizzled 5/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    317674 (Fzd5)
   04390 Hippo signaling pathway
    317674 (Fzd5)
   04150 mTOR signaling pathway
    317674 (Fzd5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    317674 (Fzd5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    317674 (Fzd5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    317674 (Fzd5)
   05205 Proteoglycans in cancer
    317674 (Fzd5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    317674 (Fzd5)
   05226 Gastric cancer
    317674 (Fzd5)
   05217 Basal cell carcinoma
    317674 (Fzd5)
   05224 Breast cancer
    317674 (Fzd5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    317674 (Fzd5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    317674 (Fzd5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    317674 (Fzd5)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  317674 (Fzd5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 317674
NCBI-ProteinID: NP_776210
RGD: 631406
Ensembl: ENSRNOG00000014678
UniProt: Q8CHL0
Position
9q32
AA seq 585 aa AA seqDB search
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGG
ECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGVCYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGSDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCS
SRRGHKSGGAMVAGDYAEASAALTGRTGPPGPAAAYHKQVSLSHV
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctagacccgacccgtccgcgccgccctctcttctgctgctgttgctggcacagctg
gtgggccgggcagcggccgcctccaaggccccagtgtgccaggaaatcacggtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccatgacactcag
gacgaagcaggcctggaggtgcaccaattctggccgctggtggagatccactgttccccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcttgcctgactaccacaag
ccgctaccaccgtgccgctccgtgtgcgagcgcgccaaggccggctgctcgccactcatg
cgccagtacggcttcgcctggcccgagcgcatgagctgcgaccgcctcccagtgctgggc
ggcgacgctgaggttctgtgcatggattataaccgaagtgaagccaccaccgcgtcccct
aagtccttcccggccaaacccacactcccaggaccaccaggggcgccatcttccgggggc
gaatgtccctcgggaggcccgtctgtgtgcacgtgccgcgagcccttcgtgcccatcctg
aaggagtcacacccactctacaacaaggtgcgcaccggccaagtgcccaactgcgcagtg
ccctgctaccagccgtccttcagcccggatgagcgcacgttcgccaccttctggattggc
ctgtggtctgtgctgtgcttcatctccacgtccaccactgtagcgaccttcctcattgac
atggaacgattccgctaccctgagcgccccatcatcttcctgtctgcgtgctacctgtgt
gtgtcactgggattcttggtgcgcctggttgtaggccatgccagcgtcgcctgcagccga
gagcacagccacattcactatgagactaccggccctgcgctgtgcacagtcgtcttcctc
ttagtctacttctttggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcggctggcatgaagtggggcaatgaagccatcgcaggctatgcacagtacttc
caccttgctgcctggctcatccccagcgtcaagtccattacggcgctggcactgagctcc
gtggacggagacccagtggctggcgtctgttatgtgggcaaccaaaacctgaactcgcta
cgaggctttgtcttgggcccactggtgctgtacctgttggtgggcacgctcttccttctg
gcaggcttcgtgtcactcttccgcatccggagcgtcatcaagcagggtggcactaagacg
gacaagctagagaagctcatgatccgcattggcatcttcactctgctctacacggtgcca
gccagcatcgtggtggcctgctacctgtatgaacagcactatcgggagagctgggaggca
gccctcacctgcgcgtgtccggggtcggacgctggccagccacgcgccaaacccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggagtctgg
atctggtccggaaagaccctggagtcttggcggcgcttcaccagccgctgctgctgcagc
tctcgacggggccataaaagcggtggcgctatggtcgcaggagactatgcggaggccagc
gccgcactcactggcaggaccgggccgccgggccccgcggccgcataccacaagcaagtg
tccctgtcgcacgtatag

DBGET integrated database retrieval system