KEGG   Rattus norvegicus (rat): 317675
Entry
317675            CDS       T01003                                 

Gene name
Tph2, Ntph
Definition
(RefSeq) tryptophan hydroxylase 2
  KO
K00502  tryptophan 5-monooxygenase [EC:1.14.16.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00380  Tryptophan metabolism
rno00790  Folate biosynthesis
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
Module
rno_M00037  Melatonin biosynthesis, animals, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    317675 (Tph2)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    317675 (Tph2)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    317675 (Tph2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.4  tryptophan 5-monooxygenase
     317675 (Tph2)
SSDB
Motif
Pfam: Biopterin_H ACT
Other DBs
NCBI-GeneID: 317675
NCBI-ProteinID: NP_776211
RGD: 631332
Ensembl: ENSRNOG00000003880
UniProt: Q8CGU9
Position
7q22
AA seq 485 aa
MQPAMMMFSSKYWARRGLSLDSAVPEEHQILGGLTQNKATASKSEDKRSGKDTSESSKTA
VVFSLKNEVGGLVRALRLFQEKHVNMLHIESRRSRRRSSEVEIFVDCECGKTEFNELIQL
LKFQTTIVTLNPPDNIWTEEEELEDVPWFPRKISELDRCSHRVLMYGTELDADHPGFKDN
VYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYLKNFPL
LTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQYVRHG
SDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFG
LCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQDAYFVSESF
EEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMN
QYLGI
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgcagcccgcaatgatgatgttttccagtaaatactgggccaggagagggttgtccttg
gattcagcggtgccagaagagcatcagatacttggcggcttaacacaaaataaggctacc
gctagcaaaagcgaggacaagagaagcggcaaagacacttcggagagcagcaagactgcg
gttgtgttctccctgaagaatgaagttggcgggctggtgagagcactgagactcttccag
gaaaaacacgtcaacatgctccatattgaatccaggaggtcccggcgaagaagttctgaa
gtcgaaatcttcgtggactgtgaatgtggcaaaacagaattcaacgagctcattcagttg
ctcaagtttcagaccaccattgtgacgctgaatccacctgacaacatttggacggaggaa
gaagaactagaggatgtgccgtggttccctcggaagatctctgagttagacagatgctct
cacagagtcctcatgtacggcaccgagcttgacgccgaccacccaggattcaaggacaac
gtctatcgacagaggaggaagtattttgtggatgtggccatgggttataaatatggccag
cccattcccagggtggaatacacagaagaagagactaaaacttggggtgttgtgtttcgg
gagctctccaaactctaccccactcatgcttgccgagagtacctgaaaaacttccccctg
ctgaccaagtactgcggctacagggaagacaacgtcccgcagctggaagacgtctccatg
tttctgaaagagcgatctggcttcacagtgagaccagtggctggctacctgagcccaaga
gacttcctggctgggctggcctacagagtattccactgcactcagtacgtgcggcatggc
tccgaccccctctacaccccggaaccagacacatgccatgagctcctgggacatgtgcca
ctgctggcggatcccaagttcgctcagttttctcaagaaataggcttagcctctctggga
gcctcagatgaagacgttcagaaactggccacgtgctatttcttcacaatcgagttcggc
ctttgcaagcaagaaggtcaactgcgggcgtacggagcagggttactttcctccatcgga
gaattgaagcatgctctttctgacaaggcgtgtgtaaaagcctttgacccgaagacaacc
tgcttgcaggaatgcctaatcaccaccttccaagatgcttactttgtttctgaaagtttt
gaagaagccaaagagaagatgagggattttgcaaagtcaattacccgtcctttctcagta
tatttcaacccctacacacagagcattgaaattctgaaagacaccagaagtattgagaat
gtggtgcaggacctgcgcagtgatttgaacaccgtgtgcgacgccttgaataaaatgaac
caatatttggggatttga

DBGET integrated database retrieval system