KEGG   Rattus norvegicus (rat): 317676
Entry
317676            CDS       T01003                                 

Gene name
Lat2, Ntal, Wbscr5
Definition
(RefSeq) linker for activation of T cells family, member 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LAT2
Other DBs
NCBI-GeneID: 317676
NCBI-ProteinID: NP_776212
RGD: 631397
Ensembl: ENSRNOG00000021856
UniProt: Q8CGL2
Position
12q12
AA seq 204 aa
MNAELELLWPLSGLLLLLLLGTTAWLCVQCSRPGVKRNEKIYEQRNQQENEQSVASSQTY
SLARPVRTGLQMDAASNKSFERKNKLLFSHLEGPESPRYQNFYKGSRRESDAAYVDPIPT
DYYNWGCFQKPPEDNDSNSYENVLICKPSTPESGTEESEDYQNSVSILQWRESKRTMGAR
TSPSGSPDEEPDYVNGDVATTEKI
NT seq 615 nt   +upstreamnt  +downstreamnt
atgaatgccgagttggagctgctgtggccactgtcaggactgttgctgctgctgctcttg
gggaccacagcttggctgtgtgtccagtgctcccgcccaggggtgaagagaaatgagaaa
atctacgagcagaggaaccagcaagaaaatgaacagagcgtagcctcatctcagacgtac
tccctggccaggccggtgcggacaggactccagatggacgcagcctcaaacaagtcattt
gagaggaagaacaagctgcttttctcccacctggagggtcctgagtcccctaggtaccag
aacttctacaaaggaagcagacgggagtctgatgctgcctatgtagatcccatccccaca
gactactacaactggggatgtttccagaagcccccagaagacaatgattccaactcctac
gagaatgtgctcatctgcaagcccagcacccccgagtcaggtactgaggaatccgaggat
taccagaactcggtatccatccttcagtggcgagaatccaagaggactatgggtgcacgc
acgtccccatcaggaagcccagacgaggagccagattacgtgaatggggatgtggccacg
acggagaaaatctag

DBGET integrated database retrieval system