KEGG   Rattus norvegicus (rat): 317715Help
Entry
317715            CDS       T01003                                 

Gene name
Gsc
Definition
(RefSeq) goosecoid homeobox
  KO
K09324  homeobox protein goosecoid
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    317715 (Gsc)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    317715 (Gsc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 317715
NCBI-ProteinID: NP_001178802
RGD: 631425
Ensembl: ENSRNOG00000010605
UniProt: G3V7E7
Position
6q32
AA seq 256 aa AA seqDB search
MPASMFSIDNILAARPRCKDAVLPVAPSAAAPVVFPALHGDSLYGAGGGTSSDYGAFYPR
PVAPGGAGLPAAVGGSRLGYNSYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGY
EGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQ
ETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSKAS
PEKREEEGKSDLDSDS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccagcatgttcagcatcgacaacatcctggccgcccggccgcgctgcaaagac
gcggtgctcccggtggcgcccagcgccgcggctccggtggtctttccggctctgcacggg
gactcgctctacggcgctggcggcggcacctcctcggactacggcgccttctacccgcgt
cctgtggcccctggaggcgcgggcctcccggccgcggtcggcggctcccgcctgggctac
aacagctacttctacgggcagctgcacgtgcaggcggcgcccgtgggcccggcctgctgc
ggggctgtgccgccgctgggcgcccagcagtgttcctgcgtcccgacgcccccaggctac
gagggccccggttctgtactggtgtctccagtgccgcaccagatgctgccctatatgaac
gtgggcacgctgtcgcgcactgagctgcagctgctcaaccagctgcactgtcgacggaag
cggcggcaccgcaccatcttcaccgacgagcagctcgaagccctggagaacctcttccag
gagacaaagtacccagacgtgggcactcgggagcaactggcccggaaggtgcacctccgg
gaggagaaggtggaggtctggtttaagaaccgccgagccaaatggagacgacagaagaga
tcctcctcagaggagtcggaaaacgctgagaagtggaacaagacgtcctcgaaagcctca
ccagagaagagggaagaggaaggtaaaagcgatttggactcggacagctga

DBGET integrated database retrieval system