KEGG   Rattus norvegicus (rat): 337868
Entry
337868            CDS       T01003                                 

Gene name
Myod1
Definition
(RefSeq) myogenic differentiation 1
  KO
K09064  myogenic factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    337868 (Myod1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    337868 (Myod1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Myogenic transcription factors
    337868 (Myod1)
SSDB
Motif
Pfam: Basic Myf5 HLH
Other DBs
NCBI-GeneID: 337868
NCBI-ProteinID: NP_788268
RGD: 631429
Ensembl: ENSRNOG00000011306
UniProt: Q02346
Position
1q22
AA seq 318 aa
MELLSPPLRDTDLLGPDGSLCSFATRDDFYDDPCFDSPDLRFFEDLDPRLVHVGALLKPE
EHAHFPTTVHPGPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR
RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAFYAP
GPLPPGRGSEHYSGDSDASSPRSNCSDGMMDYSGPPSGPRRQNGYDAAYYSEASSEPRPG
KSAAVSSLDCLSSIVERISTDSPAAPSLLLPDAPPESPPGPPEETSSSDAEQGTQTPSPD
STPQCPAGSKPNPIYQVL
NT seq 957 nt   +upstreamnt  +downstreamnt
atggagctactatcgccgccactccgggacacagacttgctaggccccgacggctctctc
tgctcctttgcgacacgcgatgacttctatgatgatccgtgtttcgactcaccagacctg
cgcttttttgaggacctggacccgcgcctggtgcacgtgggagccctcctgaagccggag
gagcacgcacacttccccactacggtgcacccaggcccaggcgctcgcgaggatgagcat
gtgcgcgcgcccagcgggcaccaccaggcgggtcgctgcttgctgtgggcctgcaaggcg
tgcaagcgcaagaccactaacgctgatcgccgcaaggcagccaccatgcgtgagcggcgc
cgcctgagcaaagtgaacgaggccttcgagacccttaagcgctgcacgtccagcaacccg
aaccagcggctacccaaggtggagatcctgcgcaacgccatccgctacattgaaggtctg
caggctctgctgcgcgaccaggacgccgctccccctggcgccgctgccttctacgcacct
ggcccgctgcccccaggccgtggcagtgagcactacagcggcgactcagacgcgtccagc
ccgcgctccaactgctctgatggcatgatggattacagcggccccccaagcggcccccgg
cggcagaatggctacgacgccgcctactacagtgaggcgtccagcgagcccagaccaggg
aagagtgcggccgtgtcgagcctcgactgcctgtccagcatagtggagcgcatctccaca
gacagccccgctgcgccttcgctgcttttgccagatgcgccaccagagtcgcctccgggt
ccgccagaggagacatcctcaagcgatgcagaacaggggacccagaccccgtctcccgac
tccacccctcagtgtcctgcaggctcaaagcccaatccgatttaccaggtgctctga

DBGET integrated database retrieval system