KEGG   Rattus norvegicus (rat): 337920Help
Entry
337920            CDS       T01003                                 

Gene name
Naglt1, Mfsd4b
Definition
(RefSeq) Na+ dependent glucose transporter 1
  KO
K08175  MFS transporter, FHS family, Na+ dependent glucose transporter 1
Organism
rno  Rattus norvegicus (rat)
Brite
Transporters [BR:rno02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Fucose:H+ symporter (FHS) family [TC:2.A.1.7]
    337920 (Naglt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 TrkH MFS_4
Motif
Other DBs
NCBI-GeneID: 337920
NCBI-ProteinID: NP_788269
RGD: 631438
Ensembl: ENSRNOG00000000590
UniProt: Q80T22
Position
20q12
AA seq 484 aa AA seqDB search
MEFRGSGATAVEQHLLQSETPGKNGLQATSSDQVGRTLRWFTTVVLNAAFLGMGVSAAVL
GPTFPDLARNVNRNISSLSEIFVGRALGYLGGSVVGGVLFDCMNHFLLLGLSHLLTAAGL
YLTPFCKTAALLTAMMSITGVSFGVLDTGGNVLILDLWGDKGAPHIQALHFSFALGAFLA
PLLAKLAWGTTASAQNHTEPQLDRSALNRSFEAASDSVLAVPDDMNLLWAYASIGTYVLV
LSVFLFAPFFKKRSKQKKSAASAQGARRAKYHRALLCLLFLFFFFYVGAEVTYGSYVFSF
ATTHVGMEESEAAGLNSIFWGTFAACRGLAIFFATLLQPGTMMVLCNIGSLASSFFLVLF
DKSPLCLWIASSVYGASMAATFPSGISWIEQYTTLTGKSAAFILVGAALGLMATPALSGI
LQGHYPDLPVILYMCLGSAVLTTVLFPVMYKVATLPLDRKQEKSINSEGQKILLSSSRLI
KEAK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggagttccgtgggtccggggccactgctgttgagcagcacctcctccagtccgagacc
ccagggaagaatgggctgcaggccacatcgagtgaccaagtgggaagaacactgcgctgg
ttcaccactgtggttctgaatgctgctttcctgggaatgggagtgagcgctgctgtgctg
ggacccacatttccagacctggccagaaacgtgaaccggaacatcagcagcctttccgaa
atcttcgtgggccgagccctcggctacctgggcggctctgtggttggtggggtgcttttc
gactgcatgaatcattttctacttttggggctgtcccacctgcttactgcggccggtctt
tacctcactcctttctgtaaaacagctgccttactgactgccatgatgtctattaccggt
gtctcatttggtgttctggatacaggtgggaatgtcctcatcttggacctttggggggac
aaaggagccccacatattcaggccttgcacttcagtttcgccttgggtgccttcctggct
cccctgctggctaaattggcctggggtaccacagcatctgctcagaaccacacagagcct
cagttagaccgttcagccttgaaccgatcctttgaagccgcctcagactctgtgttggcg
gtacctgacgacatgaatcttctgtgggcgtacgcttccattggaacctatgttctagta
ctttctgtcttcctgtttgctccattctttaaaaagaggtcaaagcagaaaaaatccgca
gcgtctgctcagggagctcgaagggctaaataccacagggccctgctatgcctcctcttc
ctcttcttcttcttctacgtgggagcggaggtgacctacggctcttacgtattctccttc
gccaccacccacgttggcatggaagagagcgaggcagctggcttgaactccatcttctgg
gggaccttcgcagcctgcaggggcctggccatcttcttcgcaacgctcttacagcctggg
accatgatggtgttgtgtaacattggcagcctggcctcatctttctttctggtgcttttt
gacaagagccctctttgcctctggatcgcgtcttctgtgtatggagcctcaatggctgcc
acgtttcccagcggcatctcctggattgagcagtacaccaccttaactgggaaatccgct
gcgttcattctggttggtgctgccctgggactaatggcgactcctgcattatctggaatt
cttcagggacactatcccgatctgccagtaattctgtacatgtgtctgggctcagcagta
ttaacaactgtgttattccctgtgatgtataaagtagccaccttacctctggatcgaaag
caggaaaaaagcatcaacagtgagggccagaaaatattactttctagctctaggctaatc
aaggaagctaaatga

DBGET integrated database retrieval system