KEGG   Rattus norvegicus (rat): 338457
Entry
338457            CDS       T01003                                 

Gene name
Tlr9
Definition
(RefSeq) toll-like receptor 9 precursor
  KO
K10161  toll-like receptor 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04620  Toll-like receptor signaling pathway
rno05132  Salmonella infection
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05144  Malaria
rno05152  Tuberculosis
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    338457 (Tlr9)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    338457 (Tlr9)
  09172 Infectious disease: viral
   05162 Measles
    338457 (Tlr9)
   05168 Herpes simplex virus 1 infection
    338457 (Tlr9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    338457 (Tlr9)
   05152 Tuberculosis
    338457 (Tlr9)
  09174 Infectious disease: parasitic
   05144 Malaria
    338457 (Tlr9)
   05142 Chagas disease
    338457 (Tlr9)
   05143 African trypanosomiasis
    338457 (Tlr9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    338457 (Tlr9)
   04090 CD molecules [BR:rno04090]
    338457 (Tlr9)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   338457 (Tlr9)
CD molecules [BR:rno04090]
 Proteins
  338457 (Tlr9)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_12 TIR LRR_6 LRR_5 FNIP TIR_2
Other DBs
NCBI-GeneID: 338457
NCBI-ProteinID: NP_937764
RGD: 631352
Ensembl: ENSRNOG00000048161
UniProt: Q6Y1S0
Position
8
AA seq 1032 aa
MVLCSRTLHPLSLLVQAAVLAEALALGTLPAFLPCELKPHGLVDCNWLFLKSVPHFSAAE
PRSNITSLSLIANRIHHLHNLDFVHLPNVRQLNLKWNCPPPGLSPLHFSCRMTIEPKTFL
AMRMLEELNLSYNGITTVPRLPSSLTNLSLSHTNILVLDASSLAGLHSLRVLFMDGNCYY
KNPCNGAVNVTPDAFLGLSNLTHLSLKYNNLTEVPRQLPPSLEYLLLSYNLIVKLGPEDL
ANLTSLRVLDVGGNCRRCDHAPDLCTECRQKSLDLHPQTFHHLSHLEGLVLKDSSLHSLN
SKWFQGLVNLSVLDLSENFLYESINKTSAFQNLTRLRKLDLSFNYCKKVSFARLHLASSF
KSLVSLQELNMNGIFFRLLNKNTLRWLAGLPKLHTLHLQMNFINQAQLSVFSTFRALRFV
DLSNNRISGPPTLSRVAPEKADEAEKGVPWPASLTPALPSTPVSKNFMVRCKNLRFTMDL
SRNNLVTIKPEMFVNLSHLQCLSLSHNCIAQAVNGSQFLPLTNLKVLDLSYNKLDLYHSK
SFSELPQLQALDLSYNSQPFSMQGIGHNFSFLANLSRLQNLSLAHNDIHSRVSSRLYSTS
VEYLDFSGNGVGRMWDEEDLYLYFFQDLRSLIHLDLSQNKLHILRPQNLNYLPKSLTKLS
FRDNHLSFFNWSSLAFLPNLRDLDLAGNLLKALTNGTLPNGTLLQKLDVSSNSIVFVVPA
FFALAVELKEVNLSHNILKTVDRSWFGPIVMNLTVLDVSSNPLHCACGAPFVDLLLEVQT
KVPGLANGVKCGSPRQLQGRSIFAQDLRLCLDDVLSRDCFGLSLLAVAVGTVLPLLQHLC
GWDVWYCFHLCLAWLPLLTRGRRSAQALPYDAFVVFDKAQSAVADWVYNELRVRLEERRG
RRALRLCLEDRDWLPGQTLFENLWASIYGSRKTLFVLAHTDKVSGLLRTSFLLAQQRLLE
DRKDVVVLVILRPDAHRSRYVRLRQRLCRQSVLFWPHQPNGQGSFWAQLSTALTRDNHHF
YNRNFCRGPTAE
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggttctctgtagcaggaccctgcaccccttgtctctcctggtacaggctgcagtgctg
gctgaggctctggccctgggtaccctgcctgccttcctaccctgtgaactgaagcctcat
ggcctggtagactgcaactggctgttcctgaagtctgtgcctcacttctctgccgcagaa
ccccgttccaacatcaccagcctttccttgatcgccaaccgcatccaccacctgcacaac
ctcgactttgtccacctgcccaacgtgcgacagctgaacctcaagtggaactgtccgccc
cctggtctcagccccttgcacttctcctgccgcatgaccattgagcccaaaaccttcctg
gctatgcgcatgctggaagagctgaacctgagctataacggtatcaccactgtgccccgc
ctgcccagctccctgacgaatctgagcctaagccacaccaacatcctggtactcgatgcc
agcagccttgctggcctgcacagcctgcgagttctcttcatggacgggaactgctactac
aagaacccctgcaacggggcggtgaacgtgaccccggacgccttcctgggcttgagcaac
ctcacccacttgtcccttaagtataacaacctcacagaggtgccccgccaactgcccccc
agcctggagtacctcctgctgtcctataacctcatcgtcaagctggggcccgaagaccta
gccaacctgacctcccttcgagtgcttgatgtgggtgggaattgccgtcgctgtgatcac
gcccccgacctctgtacagaatgccggcagaagtcccttgatctgcaccctcagactttc
catcacctgagccaccttgaaggcctggtgctgaaggacagttctctccactcgctgaac
tccaagtggttccagggtctggtgaacctctcggtgctggacctaagcgagaactttctc
tacgagagcatcaacaaaaccagcgcctttcagaacctgacccgtctgcgcaagctcgac
ctgtccttcaattactgcaagaaggtatcgttcgcccgcctccacctggcaagttccttc
aagagcctggtgtcgctgcaggagctgaacatgaacggcatcttcttccgcttgctcaac
aagaacacgctcaggtggctggctggtctgcccaagctccacacgctgcaccttcaaatg
aatttcatcaaccaggcgcagctcagcgtctttagtaccttccgagcccttcgctttgtg
gacctgtccaataatcgcatcagcgggcctccaacgctgtccagagtcgcccccgaaaag
gcagacgaggcggagaagggggttccatggcctgcaagtctcaccccagctctcccgagc
actcccgtctcaaagaacttcatggtcaggtgtaagaacctcagattcaccatggacctg
tctcggaacaacctggtgactatcaagccagagatgttcgtcaacctctcccatctccag
tgtctgagcctgagccacaactgcatcgcgcaggctgtcaatggctctcagttcctgccg
ctgaccaacctgaaggtgctggacctgtcctataacaagctggacctgtaccattcgaaa
tcgttcagtgagctcccacagttgcaggccctggacctgagctacaacagccagcccttc
agcatgcaggggataggccacaacttcagttttctggccaatctgtccaggttacagaac
cttagcctggcacacaatgacattcacagccgcgtgtcctcacgcctctacagcacctca
gtggagtatctggacttcagcggcaacggtgtgggccgcatgtgggacgaggaggacctt
tacctctatttcttccaagacctgagaagcctgattcatctggacctatctcagaataag
ctgcacatcctccggccccagaacctcaactacctccccaagagcctgacgaagctgagt
ttccgtgacaatcacctctctttctttaactggagcagtctggccttcctgcccaatctg
cgagacctggacctggcaggcaatctactaaaggccctgaccaacggcaccctgcctaat
ggcacgctcctccagaaactggatgtcagtagcaacagtatcgtctttgtggtcccagcc
ttctttgctctggcggtagagctaaaagaggtcaacctcagccataacatcctcaagact
gtggatcgctcctggtttgggcccattgtgatgaacctgacggttctagacgtgagcagc
aaccctctgcattgtgcctgcggtgcaccctttgtagacttactgctggaagtgcagacc
aaggtgcctggcctggctaacggtgtgaagtgtggcagtccccgccagctgcagggccgc
agcatctttgcgcaagacctgcggctgtgcctggatgacgtcctttctcgggactgcttt
ggcctttcactcctggctgtggccgtgggcacggtgttgcctttactgcagcatctctgc
ggctgggacgtctggtactgtttccatctgtgcctggcatggctacctttgctgacccgt
ggccggcgcagcgcccaagctctcccttatgatgccttcgtggtgttcgataaggcgcag
agcgcggttgctgactgggtgtataacgagcttcgagtgcggctagaggagcggcgcggt
cgccgagccctacgcttgtgtctggaggaccgagattggctgcctggccagacactcttc
gagaacctctgggcctccatctatggcagccgcaagactctgtttgtgctggcccacacg
gacaaggtcagtggcctcctgcgcaccagcttcctgctggctcagcagcgcctgctggag
gaccgcaaggacgtggtggtgttggtgatcctgcgccctgatgcccaccgctcccgctac
gtgcgactgcgccagcgcctctgccgccagagtgtgctcttctggccccatcagcccaac
gggcagggcagcttctgggcccagctgagtacagccctgactagggacaaccaccacttc
tataaccggaacttctgccggggacctacagcagaatag

DBGET integrated database retrieval system