KEGG   Rattus norvegicus (rat): 353118
Entry
353118            CDS       T01003                                 

Gene name
MAST1, Sast
Definition
(RefSeq) microtubule associated serine/threonine kinase 1
  KO
K08789  microtubule-associated serine/threonine kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    353118 (MAST1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     353118 (MAST1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  MAST family [OT]
   353118 (MAST1)
SSDB
Motif
Pfam: DUF1908 Pkinase PK_Tyr_Ser-Thr PDZ_6 PDZ PDZ_2 APH Kinase-like Tricorn_PDZ RIO1 Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 353118
NCBI-ProteinID: NP_851603
RGD: 631372
Ensembl: ENSRNOG00000003469
UniProt: Q810W7
Position
19q11
AA seq 1570 aa
MSDSLWTALSNFSMPSFPGGSMFRRTKSCRTSNRKSLILTSTSPTLPRPHSPLPGHLGSS
PLDSPRNFSPNTPAHFSFASSRRADGRRWSLASLPSSGYGTNTPSSTVSSSCSSQERLHQ
LPYQPTVDELHFLSKHFGSTESITDEDGGRRSPAVRPRSRSLSPGRSPSSYDNEIVMMNH
VYKERFPKATAQMEEKLRDFARAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLI
TTVYFYELQENLEKLLQDAYERSESLEVAFVTQLVKKLLIIISRPARLLECLEFNPEEFY
HLLEAAEGHAKEGHLVKTDIPRYIIRQLGLTRDPFPDVVRLEEQDSGGSNTPEQDDTSEG
RSSTSKAKKPPGESDFDTIKLISNGAYGAVYLVRHRDTRQRFAMKKINKQNLILRNQIQQ
AFVERDILTFAENPFVVGMFCSFETRRHLCMVMEYVEGGDCATLLKNIGALPVEMARMYF
AETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKMGLMSLTTNLYEGHIEKD
AREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQ
VISDDILWPEGDEALPTDAQLLISSLLQTNPLVRLGAGGAFEVKQHSFFRDLDWTGLLRQ
KAEFIPHLESEDDTSYFDTRSDRYHHVNSYDEDDTTEEEPVEIRQFSSCSPRFSKVYSSM
EQLSQHEPKTPVSASGASKRDPNAKGPEEKVAGKREGLGGLTLREKTWRGGSPEIKRFSA
SEASFLEGEASPPLGARRRFSALLEPSRFTAPQEDEDEARLRRPPRPSSDPPSSLDTRVP
KEAAQGEGTSTPGEPEATERSHPGDFCPPSKDGDPSGPRATNDLVLRRARHQQLSGDLSV
EKRPSRTGGKVIKSASATALSVMIPAVDPHGGSPLASPMSPRSLSSNPSSRDSSPSRDYS
PAVSGLRSPITIQRSGKKYGFTLRAIRVYMGDSDVYSVHHIVWHVEEGGPAQEAGLCAGD
LITHVNGEPVHGMVHPEVVELILKSGNKVAVTTTPFENTSIRIGPARRSSYKAKMARRNK
RPSAKDGQESKKRSSLFRKITKQSNLLHTSRSLSSLNRSLSSSDSLPGSPTHGLPARSPT
HSYRSTPDSAYLGASSQSSSPASSTPNSPASSASHHIRPSTLHGLSPKLHRQYRSARCKS
AGNIPLSPLAHTPSPTQASPPPLPGHTVGSSHTTQSFPAKLHSSPPIVRPRPKSAEPPRS
PLLKRVQSAEKLGASLGADKKGALRKHSLEVGHPDFRKDFHGELALHSLAESDGETPPIE
GPGATRQVAMRRLGRQESPLSLGADPLLPDGVQRPMASGKEDSAGGTEACTPPRATTPGS
RTLERDLGCTRHQSVQTEDGPGGVARALAKAALSPVQEHETGRRSSSGEAGTPPVPIVVE
PARPGVKTQTPQPLGTDSKGLKEPVAQIPLVPDAPRVRERWVLEEVEERTTLSGPRSKPA
SPKLSPDPQTPTVAPTKNVPRSAAPPVPPASLMVPGTKPEAGSNSRCPAEGVASAGLTKT
GAPSPASLGP
NT seq 4713 nt   +upstreamnt  +downstreamnt
atgtctgactctctctggaccgcgctttccaatttctcgatgccctccttccccggcggc
agcatgtttcgccgcaccaagagctgccgtaccagtaaccggaaaagcctcatcctgaca
agcacttctccgacgctaccgcgaccccactccccgctgccgggtcacttaggtagcagt
cccctggacagcccccgcaacttctctcccaacacccctgcccatttctcgtttgcttct
tcccgaagggcggatggacgccggtggtcccttgcttcccttccttcctctggatatggc
accaacaccccaagctcaaccgtctcatcctcctgctcctcccaggagcgcctgcatcaa
ctaccctaccagcccaccgtggacgagttgcactttctgtccaaacacttcggcagcacc
gagagcatcaccgacgaagatggtggccgccgctcccccgccgtgcgtcctcgctctcgg
agcctcagccccggacgctccccctcctcctacgacaacgaaatcgtgatgatgaaccat
gtgtacaaggagcggttcccgaaggccaccgcgcagatggaagagaagctgcgggacttc
gcccgcgcctacgaacctgacagcgtgctgccgctggccgacggcgtgctcagcttcatc
caccaccagatcattgaactggcccgagactgccttaccaagtcccgcgatgggctcatc
accacggtctatttctatgaactgcaggaaaacctagagaagctgctgcaggacgcctac
gaacgctcggagagcctggaggtggccttcgtcactcagctggtgaagaaactgctcatc
atcatctctcgccctgcaaggcttctggagtgcctggaattcaacccagaagaattctac
cacctgctggaggcagcggaaggccacgccaaggagggccacctggtcaaaactgacatc
ccccgatacatcatccggcagctgggcctcactcgggacccctttccagatgtggtgcgc
ctggaggagcaggacagcgggggctccaacacgcctgaacaagatgacacgtctgagggt
cgcagcagcacctccaaggccaagaaacctccgggtgaaagtgactttgacactatcaag
ctcataagcaatggtgcctacggggctgtctacctggtgcggcaccgggacacacggcag
cgctttgccatgaagaagatcaacaaacagaacttgatccttcgcaaccagatccagcag
gcgttcgtggagcgtgacatcctcacgtttgcggagaacccgtttgtggtcggcatgttc
tgctcctttgagacccggcgccatctttgcatggtcatggagtatgtggaaggtggtgac
tgtgccactctcctgaagaacattggggcactgcctgtggagatggctcgaatgtatttt
gcagaaacggttctagctcttgaatacttacacaattatggcattgtgcaccgtgacctc
aagccagacaacctcctcatcacttccatgggccacatcaaactcacggattttggcctc
tccaagatgggactcatgagcctcaccaccaacttatatgaaggtcacattgagaaagac
gcccgggagttcctggacaaacaggtgtgtgggaccccggagtacatcgcacccgaggtc
atcctgcgccagggctacggcaagccggtggactggtgggctatgggcatcattctctac
gagttcctggtgggctgtgtgcctttcttcggggataccccagaagagctctttggacag
gtcatcagtgacgacatattgtggcctgaaggggatgaggccctgcccacagacgcacag
cttctaatatctagcctcttgcagaccaaccccctggtccggcttggggcaggcggtgct
tttgaagtaaagcagcatagcttcttccgagacctagactggacggggctactgaggcag
aaggcagagttcatcccccacctagagtcagaagatgacaccagctactttgacacccgc
tccgacaggtatcaccatgtgaactcttatgatgaggacgacaccactgaggaggagccc
gtggagatccgccaattctcctcctgctcgccgcgcttcagcaaggtgtacagcagtatg
gagcagctgtctcagcacgagcccaagactcccgtctcagcatctggggctagcaagcgg
gacccaaatgctaagggcccggaggagaaggtggccggaaagagggagggactgggtggc
ctgactctgcgtgagaagacctggagagggggctctccagagattaaacgcttctcagca
tctgaagccagttttctggagggagaggccagtcccccgctgggagcgcgcagacggttc
tcagcgctactggagcccagccgcttcactgcccctcaggaggatgaagatgaggcccga
ctccgcagacctcctcggcccagctctgatccccctagctcactggacacacgcgtcccc
aaagaagcagcacaaggagagggcacatccaccccgggagaacccgaggccactgagcgc
tcacatccaggtgacttctgcccaccctccaaggatggagacccgtcaggtcctagggcc
accaatgatctggttttgcgaagggcgaggcaccagcagctgtctggggatctctcggtg
gagaagcgaccgtctcgaaccgggggcaaagttatcaagtcggcgtcagctacagccttg
tcggtcatgattcctgcagtggacccacacggaggctcacccctggctagtcccatgtcc
cctcgatctctctcctccaatccatcctctcgggactcttcgcctagccgagactactca
ccagctgtcagtggactccgctcccccatcaccatccaacgctccggcaagaaatatggc
ttcacactacgagccatccgtgtctacatgggcgactcagatgtctacagtgtccaccac
attgtttggcacgtggaggaaggaggtccagcccaagaggcagggctctgtgctggagac
ctcatcactcacgtgaacggtgagcctgtgcacggtatggtgcaccctgaggtggtggag
ctgattctaaagagtggcaacaaagtagctgtgaccaccacaccctttgaaaacacttcc
atccggattgggccggccaggcgcagcagctacaaagccaaaatggcccgcaggaacaag
aggccttcagctaaagatggccaagagagcaagaagcggagctccctcttccggaagatc
acaaaacagtcaaacctgttgcacactagccgatcgctgtcctctctgaaccggtctttg
tcgtccagcgacagtcttcctggttcgcccacgcacggactacccgcacgctcgcccacg
catagctatcgctccacacctgactccgcctacctaggtgcctcgtcacagagtagctct
ccagcttccagcacacctaattcccccgcctcatccgcctcgcaccacatcaggcccagc
actctgcacgggctgtcaccgaaactacaccgccagtatcgttcagcgcgctgtaaatcg
gctggcaacatcccgctgtcacctctggcgcacactccgtccccgacgcaggcgtcgccg
ccgccgctgccaggccacacggtgggcagctcccataccacgcagagcttccctgccaaa
ctgcactcatcgccgcctatcgtgcgtccgcgccccaaaagtgcagagccaccacgctcg
ccgttgctcaagcgcgtgcagtcagcggaaaagctaggggcttcgctgggagcagacaag
aagggagcattgcgcaaacacagtctggaagtgggtcaccctgatttccgaaaggacttc
cacggtgagctggcgctgcatagcctcgctgagtccgatggtgagacgcctcctattgag
ggtcctggggcgacccggcaggtcgccatgagacgcctgggccgccaggaatctccccta
agcttgggcgcggacccgttgctacccgatggtgtccagagacctatggcgtcaggcaag
gaggattccgcgggaggtacagaggcttgtactccacctcgcgcgactacccctgggagc
cggaccctggagcgtgacttgggctgcacaaggcaccagagcgtgcagactgaggatggc
ccaggtggggtggccagagccctggccaaggcagcgctaagcccggtgcaggaacatgag
acaggccggcgcagtagctccggtgaggcaggaacacccccggtgcccattgttgtagag
cctgcccggccaggggtcaagacccagacaccccagcctctgggcacagactccaaggga
ttgaaggaacctgtagcccagatccctctggtgcctgatgccccaagggtccgggagcgc
tgggtgctagaggaggtggaagagcggaccacgttaagcggacctcgctctaagcccgcc
tcccccaaactctctcctgacccccagactccaaccgtagccccaacaaagaatgtaccc
cgcagtgcagctcctccagtcccacctgcttccctaatggtcccaggtacgaagcccgaa
gcagggtcgaactcccggtgtcctgctgaaggtgtggcttcagcaggcctaaccaaaacg
ggggcacccagtcctgcatctttaggtccatga

DBGET integrated database retrieval system