KEGG   Rattus norvegicus (rat): 353218
Entry
353218            CDS       T01003                                 

Gene name
Tnfsf9, Tnlg5a
Definition
(RefSeq) tumor necrosis factor superfamily member 9
  KO
K05472  tumor necrosis factor ligand superfamily member 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    353218 (Tnfsf9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    353218 (Tnfsf9)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   353218 (Tnfsf9)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 353218
NCBI-ProteinID: NP_852049
RGD: 727974
Ensembl: ENSRNOG00000045595
UniProt: Q80WE6
Position
9q12
AA seq 308 aa
MDQHALDVGGTVDAGHPPGTAQPPDAAFLRDTGLPSDAAFLVDTVRLTEAALPTDAACPA
VNVRDPEAAWPPALNFCSRHPRLYCLGGLVLLLLVACVPIFIRILPQPALTITTSPDLDT
GENTADQVTPVSHIGCANTTQQGFPVFAKLLAKNQASLSNTTLNWHSQEGAGSSYLSRGL
RYEEDKKELVVDSPGLYYVFLELKLSPTSINTGRKVQGWVSLVLQAKPQVDHLDSLALTV
ELFPCSMEDKLVDRSWNRLLRLKAGHRLSVDLRAYLHGAQDAYRDWELSHANTTSFGLFL
VKPDPPQG
NT seq 927 nt   +upstreamnt  +downstreamnt
atggaccagcacgcacttgatgttggggggaccgtggatgccggacatccaccaggtact
gcgcagcccccggatgcggcgttcctcagagataccgggctcccttcggatgctgcgttc
ctggtagatactgtgcgcctcacagaagctgcgctgcccacggatgctgcgtgccctgcg
gttaatgttcgggatcctgaggccgcgtggccgccggccctgaacttttgttcccgccac
ccgaggctttactgcctaggcggcttggtgttgctgctcctggtcgcctgtgtccctatc
ttcatccgcatcctacctcagcccgcgctcacaatcaccacctcgcctgacctggatacc
ggagagaatactgcagaccaggtcacccctgtttcccacattggctgcgccaacactaca
caacagggttttcccgtgttcgccaagctactggctaaaaaccaagcatcgctgagtaac
acgactctgaactggcacagccaggagggagctgggagctcatacctgtctcgaggtctg
aggtacgaggaggacaaaaaggagttggtggtggacagtcctgggctctactacgtgttc
ttggaactgaagctcagtccaacgtccataaacacaggccgcaaggtgcagggctgggtc
tcccttgttttgcaagcaaagcctcaggtagatcaccttgacagcttggccctgacagtg
gaattgttcccttgctccatggaggacaaattagtggatcgttcctggaatcgtctgttg
cgcctgaaggctggtcaccgcctcagtgtggatctgagggcctatctgcatggagcccag
gatgcatacagagactgggagctgtctcatgccaacaccaccagctttggactcttcctt
gtgaaacctgacccccctcagggatga

DBGET integrated database retrieval system