KEGG   Rattus norvegicus (rat): 353233Help
Entry
353233            CDS       T01003                                 

Gene name
Nsmaf, FAN
Definition
(RefSeq) neutral sphingomyelinase activation associated factor
  KO
K18953  factor associated with neutral sphingomyelinase activation
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    353233 (Nsmaf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beach GRAM WD40 PH_BEACH ANAPC4_WD40 WD40_like eIF2A
Motif
Other DBs
NCBI-GeneID: 353233
NCBI-ProteinID: NP_852054
RGD: 727868
Ensembl: ENSRNOG00000010234
UniProt: Q7TSY5
Position
5q12
AA seq 920 aa AA seqDB search
MAFTRKRQREQQLQLYSKERFSLLLLNLEEYYFEQHTAFHVQHQGSPEERKIRGSLKICS
KSVIFEPDAISQPILKIPLRDCLKIGKHGENGANKHFAKAKSLGISLISSQVYFIKEHNI
VAPYKIERGKMEYVFQLEVSGKVEDVVETLLQLHRASCLDKLGDQMAMITAILQSRLART
SFDKNRFQSVSEKLHMECKAEMMTPLVTNSGHVCITDTNLYFQPLNGYPKPVVQITLQDV
RRIYKRRHGLMPLGLEVFCTEDDLCSDIYLKFYEPQDRDDLYFYIATYLEHHVAEHTAES
YMLQWQRGHLSNYQYLLHFNNLADRGCNDLSQYPVFPWVISDYSNPELDLSNPATFRDLS
KPVGALNPERLERLLTRYQEMPEPKFMYGSHYSSPGYVLFYLVRIAPEYMLCLQNGRFDN
ADRMFNSIVETWKNCLDGATNFKELIPEFYDEDASFLINSLKLDLGKRQGGQMVDDVELP
AWASSPQDFLQKNKDALESSYVSEHLHEWIDLIFGYKQKGSEAIGAHNVFHPLTYEGGVD
LNSIEDPDDKVAMLTQILEFGQTPKQLFVTPHPRRITPKFKSLSQASSYNASMTDSPVSP
GEESFEDLTEESKTLAWNNITKLQLHEQYKIHKEAVTGIAVSCNGSSVFTTSQDSTLKMF
SKESKMLQRSISFSIWALSSCLLLPGDTTVISSSWDNNVYFYSIAFGRRQDTLMGHDDAV
SKICWHNDRLYSASWDSTVKVWSGVPAEMPGTKRHQFDLLAELEHDVSVNTINLNAVSTL
LVSGTKEGLVNIWDLTTATLLHQISCHSGTVCDAAFSPDSRHVLSTGVDGCLNVIDVQTG
MLISSMASEEPQRCFVWDGNSVVSGSRTGELLVWDLLGAKVSERIQGHTGAVTCIRMNEQ
CSSIITGGEDRQVMFWKLQY
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcacccggaagaggcagcgcgagcagcagctgcagctctactccaaggagagg
ttctccttactgctgctcaacttggaggagtactacttcgagcagcatacggctttccat
gtccagcaccagggcagccccgaggaaaggaaaatcagaggctccttaaagatatgttca
aaatcagtgatttttgaaccagatgcaatatcgcagcccattcttaagattcctttgaga
gactgtttaaaaataggaaaacatggagaaaatggagccaataaacactttgcaaaggca
aaatctttgggtatttcactcatttccagtcaggtatatttcattaaggagcacaacatc
gtggcaccgtataagatagaacggggaaaaatggagtatgtcttccaactggaagtttct
gggaaggtggaagatgttgtggagacattgctacagctgcacagagcatcctgccttgat
aaacttggtgaccaaatggccatgataacagctatcttgcagtcacgtttggctaggaca
tcatttgacaaaaacaggttccaaagcgtttcagaaaagctgcacatggagtgcaaagca
gagatgatgacgcctctggtgacgaactctgggcatgtgtgcattactgacaccaacctg
tatttccagcctctcaacgggtacccgaaacctgtggtccagataacgctccaagatgtc
cggcgcatttacaaaaggaggcacggcctcatgcctttgggcttggaagtgttttgcaca
gaagatgacctgtgttctgacatatacctaaagttctatgagcctcaagacagagatgac
ctctatttttatattgccacgtacctagaacaccacgtggcagaacacactgcggagagc
tacatgctgcagtggcagcgagggcacctgtccaactaccagtacctgctccacttcaac
aacctggccgaccgcggctgcaatgacctgtcccagtaccctgtgtttccatgggtaata
agtgactactccaacccagagctagatttgtcaaatcccgcaaccttccgagatcttagt
aagccagtgggagccctaaatccagagaggctggagagactgctgactcgataccaggaa
atgcctgagccgaagttcatgtatgggagccactactcttccccaggctatgtgctcttt
tacctcgttaggatcgcaccagaatatatgctgtgtctacaaaatggaagatttgataat
gcagataggatgttcaacagcattgtagaaacctggaaaaactgtttggatggtgcaacg
aacttcaaagagttgatcccagaattctatgatgaagacgccagcttcttgatcaatagt
ctgaagttggatctggggaagagacaaggagggcagatggttgacgacgtggagcttcct
gcatgggcctcaagtccccaagactttctccagaagaacaaggacgccttggaaagcagt
tatgtgtctgagcaccttcatgagtggattgatctgatatttggctataagcaaaaaggg
agtgaggccataggggcccataacgtgtttcaccccctgacctatgaaggcggtgtagac
ctgaacagcattgaggatcccgatgacaaagtagccatgctgacccaaattttggaattt
gggcagacaccaaaacagctgtttgtgacaccacatcctcgaaggatcacccccaagttt
aaaagtttgtcccaagcgtccagctacaatgcttctatgacagactccccagtttctcca
ggggaggagtcatttgaagacctgactgaagagagcaaaactctggcctggaataacatc
accaagttgcagctacatgagcagtacaaaatccacaaagaggcggttacagggatagca
gtgtcttgcaatgggtcttcagtctttaccacctcacaagattccactttgaagatgttt
tctaaggaatccaaaatgttacaaagaagtatatcattttcaatatgggctttatcgtct
tgtttacttttgccaggagacaccactgtcataagttcttcttgggataacaacgtctat
ttttattccatagcatttggaagacgccaagacacactgatgggacatgacgatgctgtc
agtaagatctgttggcataatgacaggctgtactctgcatcttgggactctactgtgaag
gtgtggtccggcgttcctgcagaaatgccaggcacaaaaagacaccagtttgacttactg
gctgagcttgagcatgatgtcagtgtcaatacgatcaatttaaatgctgtgagtacactg
ctagtttctggcaccaaggaaggcctggtgaatatttgggacctcactacagccactcta
ttacaccagatttcatgccactcagggacagtatgtgatgctgcttttagcccagacagt
cgccacgtcctcagcacaggagtagacggctgcctgaacgtgattgatgtgcagacgggc
atgctcatttcctccatggcctcagaggagccgcagaggtgctttgtctgggatggaaac
tctgtcgtatctggaagtcggactggtgagctgcttgtctgggacctccttggagcaaaa
gtcagtgagcggatacagggccacacaggtgccgtgacgtgcatacggatgaatgaacag
tgtagcagcatcatcaccggaggggaagacagacaagttatgttctggaaactgcagtat
taa

DBGET integrated database retrieval system