KEGG   Rattus norvegicus (rat): 353250Help
Entry
353250            CDS       T01003                                 

Gene name
Niacr1, Gpr109a, Gpr109b, Hcar2, Hm74, Hm74b, Pumag, rHM74b
Definition
(RefSeq) niacin receptor 1
  KO
K08402  hydroxycarboxylic acid receptor 2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    353250 (Niacr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    353250 (Niacr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Hydroxy-carboxylic acid
    353250 (Niacr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 SpoIIM
Motif
Other DBs
NCBI-GeneID: 353250
NCBI-ProteinID: NP_852141
RGD: 727952
Ensembl: ENSRNOG00000026653
UniProt: Q80Z39
Position
12q15
AA seq 360 aa AA seqDB search
MSKQNHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR
IFLFNLAVADFLLIICLPFLTDNYVQNWDWRFGSIPCRVMLFMLAMNRQGSIIFLTVVAV
DRYFRVVHPHHFLNKISNRTAAIISCFLWGITIGLTVHLLYTDMMTRNGDANLCSSFSIC
YTFRWHDAMFLLEFFLPLGIILFCSGRIIWSLRQRQMDRHVKIKRAINFIMVVAIVFVIC
FLPSVAVRIRIFWLLYKHNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN
FFSTCINRCLRRKTLGEPDNNRSTSVELTGDPSTIRSIPGALMTDPSEPGSPPYLASTSR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcagaaccactttctggtgataaacggcaagaactgctgtgtgttccgagat
gaaaacatcgccaaggtcctgccgccggtgttggggctggagtttgtgtttggactcctg
ggtaatggccttgccttgtggatcttctgtttccatctcaaatcctggaaatccagccgg
attttcttgttcaacctggccgtggctgactttctcctgatcatttgcttgccgttcttg
acggacaactatgtccagaactgggactggaggttcgggagcatcccctgccgcgtgatg
ctcttcatgttggccatgaaccgacagggcagcatcatcttcctcacggtggtggctgtg
gacaggtacttcagggtggtccacccgcaccacttcctgaacaagatctccaaccggacg
gcggccatcatctcttgcttcctgtggggcatcaccatcggcctgacagtccacctcctc
tacacggacatgatgacccgaaacggcgatgcaaacctgtgcagcagttttagcatctgc
tacactttcaggtggcacgatgcaatgttcctcttggaattcttcctgcccctgggcatc
atcctgttctgctctggcaggatcatttggagcctaaggcagagacagatggacaggcac
gtcaagatcaagagggccatcaacttcatcatggtggttgccattgtgtttgtcatctgc
ttcctgcccagtgtggccgtgaggatccgcatcttctggctcctctacaaacacaacgtg
aggaactgtgacatctactcctctgtggacttggccttcttcaccacccttagctttacc
tacatgaacagcatgctcgacccggtggtctactatttctccagcccatctttccccaac
ttcttctccacgtgcatcaaccgttgccttcgaaggaaaaccttgggcgaaccagataat
aaccggagcacgagtgtggagctcacgggggaccccagcacaatcagaagtattccaggg
gcattaatgactgaccccagtgagccaggcagccccccttatctggcttccacatctcgt
taa

DBGET integrated database retrieval system