KEGG   Rattus norvegicus (rat): 359728Help
Entry
359728            CDS       T01003                                 

Gene name
Rab40c
Definition
(RefSeq) Rab40c, member RAS oncogene family
  KO
K07928  Ras-related protein Rab-40
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    359728 (Rab40c)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    359728 (Rab40c)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     359728 (Rab40c)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab40
    359728 (Rab40c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc SOCS_box Arf
Motif
Other DBs
NCBI-GeneID: 359728
NCBI-ProteinID: NP_872616
RGD: 727914
Ensembl: ENSRNOG00000020067
UniProt: Q6Y2E6
Position
10q12
AA seq 281 aa AA seqDB search
MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLASGAGGSGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgggcacccagggcagtccagtgaagagctacgattacctgctcaagttcctgctggtg
ggcgacagcgacgtgggcaaaggcgagattctggagagtcttcaggacggagcagccgaa
tccccgtacgcctacagcaacggaatagactataagactaccaccatcctactagatgga
cggcgtgtcaagctggagctatgggatacttcgggccagggaaggttctgtaccatcttc
aggtcctactcgaggggtgcgcagggaatccttctggtgtacgacatcaccaaccgttgg
tcctttgatggcattgaccggtggatcaaggagattgatgagcatgcacctggtgttccc
cggatcctggttggaaaccggctgcacctcgccttcaagcggcaagtcccaacggagcag
gccagagcctacgcagagaagaactgcatgaccttctttgaagtcagcccgctgtgcaac
ttcaacgtcattgagtccttcactgagctctcccgcattgtgctcatgcggcatggcatg
gagaagatctggaggcccaatcgagttttcagcctgcaggacctctgctgccgtgccatt
gtctcctgtactcctgtgcacctcatcgacaagctccctctacctgtcaccatcaagagc
cacctcaagtccttttccatggccaacggcatgaatgctgtcatgatgcacggccgctcc
tactccctggcaagtggggccgggggcagtggcagcaagggcaacagccttaagaggtcc
aagtccatccgtcccccccagagcccacctcagaactgctctcggagcaactgcaagatc
tcctag

DBGET integrated database retrieval system