KEGG   Rattus norvegicus (rat): 360161
Entry
360161            CDS       T01003                                 

Gene name
Nek6
Definition
(RefSeq) NIMA-related kinase 6
  KO
K20875  NIMA (never in mitosis gene a)-related kinase 6 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    360161 (Nek6)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    360161 (Nek6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     360161 (Nek6)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  NEK family
   360161 (Nek6)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    360161 (Nek6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo RecG_N
Other DBs
NCBI-GeneID: 360161
NCBI-ProteinID: NP_001264161
RGD: 727779
Ensembl: ENSRNOG00000010897
UniProt: P59895 B1H218
Position
3q12
AA seq 313 aa
MAGQPSHMPHGGSPNHLCHVLGPAHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVY
KATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNI
VLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFI
TATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEM
AALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNHRPDIEYVH
QVAKQMHVWTSST
NT seq 942 nt   +upstreamnt  +downstreamnt
atggcaggacagcccagccacatgcctcatggagggagcccaaaccacctctgccacgtg
ctggggcctgcacaccctccggacccacagaggcacccaaacaccctgtcttttcgctgc
tcactggcagacttccaaatcgagaagaagattggccgaggacagttcagtgaggtctac
aaagccacctgcctgctggacaggaagacagtggctctgaagaaggtgcagatttttgag
atgatggatgccaaagccagacaggactgtgtcaaagaaattggtctcctaaagcaactg
aaccatccaaacatcattaagtacctggactccttcatcgaagacaatgagctgaacatt
gtgctggagttggctgacgcaggtgacctctcacagatgatcaagtatttcaagaagcag
aagcggcttatccctgagaggactgtgtggaagtacttcgtgcagctgtgcagcgctgtg
gagcacatgcattcccgacgtgtgatgcaccgagacatcaagcctgccaacgtgttcatc
acagctacgggcatcgtgaagcttggtgacctcggcctgggccgcttcttcagctcagag
accactgcagcccactcgctagtgggaacaccatactatatgtcacccgagaggatccac
gagaatggctacaacttcaagtcagacatctggtccctaggctgcctgctgtatgagatg
gcagctcttcagagccccttctatggagataagatgaatctcttctccctctgccagaag
attgagcagtgtgactacccgcctctcccgggggagcactactctgagaagcttcgggaa
ctggtcagcatgtgcatctaccccgaccctaaccaccgacctgacattgagtatgtgcac
caggtggctaaacagatgcacgtctggacatccagcacctga

DBGET integrated database retrieval system