KEGG   Rattus norvegicus (rat): 360230
Entry
360230            CDS       T01003                                 

Gene name
Stk40, Lyk4, RGD1307310
Definition
(RefSeq) serine/threonine kinase 40
  KO
K16312  serine/threonine-protein kinase 40 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    360230 (Stk40)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     360230 (Stk40)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  Other
   360230 (Stk40)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 360230
NCBI-ProteinID: NP_898879
RGD: 727884
Ensembl: ENSRNOG00000025679
UniProt: Q7TNL4 A0A0G2JST8
Position
5q36
AA seq 435 aa
MKRRASDRGAGETSAKAQALGTGIAGNNAKRAGPFILGPRLGNSPVPSIVQCLARKDGTD
DFYQLKILTLEERGEQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEA
VEDTESGRMVKKMKKRICLVLDCLCAHDFSDKTADLINLQHYVIKEKRLSERETVVIFYD
VVRVVEALHQKNIVHRDLKLGNMVLNKRTHRITITNFCLGKHLVSEGDLLKDQRGSPAYI
SPDVLSGRPYRGKPSDMWALGVVLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPEDGRVS
ENTVCLIRKLLVLDPQQRLAAADVLEALSAIIASWQSLSSLSGPLQVVPDIDDQMSSSDS
SQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHEARTWVPKRQFGSMPPVRRLGHDAQPM
TSLDTAILAQRYLRK
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgaagcggagagcatcagacagaggagctggggagacgtcggccaaggcccaggctcta
gggactggcattgctggaaataatgcaaagagagcaggaccgttcatcctgggtccccgc
ctgggcaactcaccggtaccgagcattgtgcaatgtttggcaaggaaagacggcacggac
gacttctatcagttgaagatcctcacccttgaggagaggggcgagcaaggaattgagagc
caagaggagaggcagggcaagatgctgctgcataccgagtactctctgctgtccctgctg
cacacacaggatggcgtggtccaccaccatggcctcttccaggaccgcacgtgtgaagcg
gtcgaggacacagagtctgggcggatggtaaagaagatgaagaaacgcatttgccttgtc
cttgactgcctctgtgcacacgacttcagtgacaagaccgctgacctcatcaacctacag
cactacgtcatcaaagagaagcggctcagtgagcgtgagactgtggtcattttctatgat
gtagtccgtgtggtagaagccctgcaccagaaaaacatcgtgcacagagacctgaagctt
gggaacatggtgctcaataaaaggacccatcggataactatcaccaacttctgccttgga
aagcaccttgtgagtgagggggacctgctgaaggaccagagggggagccctgcctacatc
agtcctgatgtgctcagcggccggccataccgggggaagcctagtgacatgtgggccttg
ggcgtggtgctcttcaccatgctctatggccagttccccttctacgacagcatcccacag
gagctcttccgcaagatcaaggctgctgagtacaccatccctgaggatgggcgagtctct
gagaacacagtgtgtcttatccggaaactactggtccttgacccccagcaacgcctggct
gctgcagatgtcctggaggccctcagtgccatcattgcatcttggcagtccctgtcctct
ctgagtgggcctttgcaagtggttcctgacatcgatgaccaaatgagcagctctgacagc
tcccaggaggcaaaggtcacagaggaatgctcccagtacgagtttgagaattacatgcga
cagcagctgctgctggctgaagagaagagctccattcacgaggcccggacctgggtaccc
aagcggcagtttggtagcatgccacccgtccgacggctaggccacgatgcacagccaatg
acctccttggacacagccatcctggcacaacgctatctgcggaaatag

DBGET integrated database retrieval system