KEGG   Rattus norvegicus (rat): 360389
Entry
360389            CDS       T01003                                 

Gene name
Zfp422, Kox15, Krox-25, Znf22
Definition
(RefSeq) zinc finger protein 422
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_11 zf_UBZ Zn-ribbon_8 zf-C2H2_6 C1_4 zf-H2C2_5 XPA_N
Other DBs
NCBI-GeneID: 360389
NCBI-ProteinID: NP_001012763
RGD: 620229
Ensembl: ENSRNOG00000013379
UniProt: Q9ERU2
Position
4q42
AA seq 237 aa
MRLGKPKGGISRSASQGKTYESKRKTARQRQKWGVAIRFDSGLSRRRRNVDEKPYKCTKC
SKSFSQSSTLFQHKKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGERF
KQSSNLIQHQRIHTGEKPYCCDECGRCFSQSSHLIQHQRTHTGEKPYQCEECDKCFSQSS
HLRQHMKVHKEKKSHKRGKNARAKTHPVSWKRGKGRKAVAGLRQVKGAASGLFKKKK
NT seq 714 nt   +upstreamnt  +downstreamnt
atgaggttaggaaagcctaaggggggtatttctcgaagtgcaagccaaggaaaaacctat
gagagcaagcgcaagacagcccgccagcgacagaaatggggggtggccattcgcttcgac
tcagggttaagtagacggagaagaaacgtggatgagaagccttacaaatgtactaaatgt
tctaagagtttcagtcagagctccactctttttcagcacaagaagatccacactgggaag
aaatcccataaatgtgccgattgtgggaaaagtttctttcagagttctaacctcattcag
catcggcggatccacacgggggaaaagccctataagtgcgacgagtgtggagagagattt
aaacagagctccaaccttatccagcaccagaggattcacaccggggagaagccctattgc
tgcgatgagtgtggccggtgctttagccagagttcccacctcattcagcaccagagaacc
cacaccggagaaaagccctaccagtgcgaggagtgtgacaagtgcttcagccagagctcc
cacctgaggcagcacatgaaggtgcacaaagaaaagaagtcacataaaaggggtaaaaat
gccagggcgaaaactcacccggtgtcctggaaacgtggtaaaggaaggaaggcagtggct
gggctccgccaggtaaagggagccgcttcgggccttttcaaaaagaagaagtga

DBGET integrated database retrieval system