KEGG   Rattus norvegicus (rat): 360420
Entry
360420            CDS       T01003                                 

Gene name
Rdh7, RGD1307178, Rdh3, RoDH(III)
Definition
(RefSeq) retinol dehydrogenase 7
  KO
K11154  retinol dehydrogenase 16 [EC:1.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    360420 (Rdh7)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     360420 (Rdh7)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR Latarcin Glycoprot_B_PH2
Other DBs
NCBI-GeneID: 360420
NCBI-ProteinID: NP_598227
RGD: 631370
UniProt: P55006
Position
7q22
AA seq 317 aa
MWLYLLALVGLWNLLRLFRERKVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAAC
LTEKGAEQLRSKTSDRLETVILDVTKTESIVAATQWVKERVGNRGLWGLVNNAGISVPMG
PNEWMRKKDFASVLDVNLLGVIEVTLNMLPLVRKARGRVVNIASTMGRMSLLGGGYCISK
YGVEAFSDSLRRELTYFGVKVAIIEPGGFKTNVTNMERLSDNLKKLWDQATEEVKEIYGE
KFRDSYMKAMESLVNMCSGDLSLVTDCMEHALTSCHPRTRYSAGWDAKFFYLPMSYLPTF
LSDAVIYWGSVKPARAL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtggctctacctgctggcactggtgggcctgtggaacctcctgcgcttgttcagggag
aggaaggtggtgagccatctccaagacaagtatgtcttcatcacgggctgtgactcaggc
tttgggaacctgctggccagacagctggacaggagaggcatgagggtgctggctgcatgt
ctgactgagaagggagccgagcagctgaggagcaagacatcggacaggctggagacagtg
atccttgatgtcaccaagacagagagtattgtggcagccactcagtgggtgaaggagcga
gttgggaacagaggactctggggcctggtcaacaatgctggcatctctgtccccatgggt
cccaatgagtggatgagaaaaaaggactttgcaagtgtgctggatgtgaacctgttgggc
gtcatcgaggtgactctgaacatgctgcccttagtaaggaaggcaaggggccgcgtggtc
aacatcgccagcaccatgggccgaatgtctctccttggtggtggttactgcatctccaag
tatggtgtagaggccttctcagactccctcaggagggagctcacctactttggggtgaag
gtggctattatagagcctggtgggttcaagaccaatgtcactaatatggagaggctatca
gacaacctgaagaagctgtgggaccaggccactgaggaggtcaaggagatctacggcgag
aagtttcgggactcctatatgaaagcaatggagtcactggtgaacatgtgctcaggggac
ctgtctctggtaaccgactgcatggagcacgccctgacttcctgtcaccctcgcacccgg
tactcagctggttgggatgccaagttcttctacctccccatgagctaccttcccaccttt
ctttcggatgccgtaatctactggggctctgtaaagcctgcccgagccctgtga

DBGET integrated database retrieval system