KEGG   Rattus norvegicus (rat): 360476
Entry
360476            CDS       T01003                                 

Gene name
Nagpa
Definition
(RefSeq) N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
  KO
K01125  N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase [EC:3.1.4.45]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    360476 (Nagpa)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.45  N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
     360476 (Nagpa)
SSDB
Motif
Pfam: NAGPA EGF_2 EGF_Tenascin
Other DBs
NCBI-GeneID: 360476
NCBI-ProteinID: NP_001101735
RGD: 1308972
Ensembl: ENSRNOG00000002895
Position
10
AA seq 517 aa
MAAPRGPGLFFKPALLGLLGVAWCSLGFGVSRDDDLLLPYPLARRRPSRDCARVHAGSPE
QESWPPPPTNPGASHRAAVRTFVSHFEGRAVAGHLTRVADPLRTFSVLEPGGPGGCAQRR
RATVEDTAVPAGCRVAQNGGFFRMGTGECLGNVVSDGRLVSSSGGLQNAQFGIRRDGTLV
TGYLSEEDVLDTVNPFVQLLSGVVWLIRNGSIYINESQITECDETQETGSFSKFVNVMSA
RTAVGHDRKGQLILFHADGQTEQRGLNLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTL
ASYPSDHCQDNMWRCPRRVSTVVCVHEPRCQPPNCSGHGTCVDGRCECTSHFWHGEACSE
LNCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWYGPGCQRPCQCEHQRPCDPQTG
NCSISQVKQCLQSTEAPPRAGGLASFTGTTWLALTLILIFLLLISTAVNVSLLLGSRAER
NRHLDGDYVYHPLQEVNGDALAAEKEQTEETCNPFKD
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcggcgcccagggggccggggctgttcttcaaacccgcgctgctcggtttgcttggg
gtggcgtggtgcagcttaggcttcggggtttcccgagacgatgacctgctgctgccttac
ccactcgcgcgcagacgtccctcgcgggactgcgcccgggtgcacgcaggcagcccagaa
caggagagctggcctccgccacccacgaaccccggcgccagccaccgcgcggccgtgcgc
acctttgtgtcgcacttcgagggacgcgcggtggccggccacctgacgcgggtggctgac
cccctacgcactttctcggtgctggagccgggaggacccggaggctgcgcgcagaggcgt
cgcgctactgtggaggacacagccgtcccggccggttgccgcgtcgctcagaacggtggc
ttcttccgcatggggactggcgagtgcttggggaatgtggtgagcgacgggcggctggtg
agcagctctgggggactgcagaacgctcagttcggtatccgacgcgacgggaccttagtc
accgggtacctgtctgaggaggacgtcctggacacggtgaacccattcgtgcagctactg
agcggagtggtatggctcatccgtaatggaagcatctacatcaacgagagccaaatcacc
gagtgcgatgagacgcaggagacaggttctttcagcaaatttgtgaacgtgatgtcagcc
aggacagccgtgggtcatgaccgtaaggggcagcttatactcttccacgcggacggacag
acggagcagcgtggcctcaacctgtgggagatggcagagttcctgctgaaacaagacgtg
gtcaatgccatcaacctggatggaggcggttctgccacctttgtgctcaatgggacccta
gccagttacccctcagatcactgccaggacaacatgtggcgctgtccccgccgtgtttcc
actgtggtatgtgtgcatgaaccccgctgccagccacccaactgcagcggccatgggacc
tgtgtggatggccgttgtgaatgcaccagccacttctggcacggtgaagcctgcagtgag
ctgaactgcggcccctccaactgcagccagcatgggctctgcacagagactggctgcagg
tgtgatgctgggtggacaggatccaactgcagtgaagagtgtcctctgggctggtatggg
ccaggttgccagaggccttgccagtgcgagcaccagcgtccctgtgacccccagactggc
aactgcagcatctcccaagtgaagcagtgtctccagtcaactgaggccccaccgagggca
ggagggctggcctctttcaccgggaccacgtggctggcacttaccctcatcctaattttc
ctgctgctgatcagcacggccgtcaacgtgtccttgctcctgggctcccgggcagagagg
aaccggcacctcgacggggactacgtgtaccacccactgcaggaggtgaacggggacgcg
ctggctgcagagaaggagcaaacagaggaaacttgcaaccccttcaaggactga

DBGET integrated database retrieval system