KEGG   Rattus norvegicus (rat): 360498Help
Entry
360498            CDS       T01003                                 

Gene name
Jmjd8, RGD1307381
Definition
(RefSeq) jumonji domain containing 8
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 Cupin_4 JmjC Cupin_2
Motif
Other DBs
NCBI-GeneID: 360498
NCBI-ProteinID: NP_001014138
RGD: 1307381
Ensembl: ENSRNOG00000019729
UniProt: Q6AY40 A0A140TAD7
Position
10q12
AA seq 271 aa AA seqDB search
MLMAAAGRFGLLLLIVLWTMVTVVLPASGEGGWKQSRLGTEAAVMEEERCTVERRAHLTY
SEFMQHYAFLKPVILQGLTDNSKFRALCSRENLLASFGDNVVRLSTANTYSYQKVDLPFQ
EYVEQLLHPQDPESLGNDTLYFFGDNNFTEWAPLFQHYRPPPFRLLGTTPAYSFGIAGAG
SGVPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTTLAWLLEIYPSLAPSARPLECT
IQAGEALYFPDRWWHATLNLDTSVFISTFLG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgctcatggcggcggctggacgattcggtctgcttttgctcattgtactatggacgatg
gtgactgtggttctgcctgcctctggcgaagggggatggaaacagagtaggctgggaact
gaagcagcggtgatggaggaggaacgttgcacagtcgagcgccgagcacacctcacgtac
tccgaatttatgcagcactatgccttcctcaagcccgtcatcttgcaaggactcacagac
aactcgaagttcagagccctgtgttcccgggaaaacctgctggcctcgtttggggacaat
gttgttcgcttgagtacagccaacacctactcctaccagaaagtggacctgcctttccag
gaatatgtggagcagctgctgcacccccaggaccccgaatctctaggcaatgacaccctg
tactttttcggagataacaactttactgagtgggccccactcttccaacattaccgtcca
cctccatttcgtctactgggaaccacccctgcttatagctttggaattgcaggagctgga
tctggggtacccttccactggcatgggcctggtttctcagaggttatctatggtcggaag
cgctggttcctctaccctcctgagaagacacctgagttccaccctaacaagaccacgttg
gcctggctcctggaaatatacccatctctagccccatcagctcggcctctagaatgtacc
atccaggctggtgaagcgctgtactttcctgatcggtggtggcatgccacactcaatctg
gacaccagtgtcttcatatccactttccttggctag

DBGET integrated database retrieval system