KEGG   Rattus norvegicus (rat): 360503Help
Entry
360503            CDS       T01003                                 

Gene name
Luc7l
Definition
(RefSeq) LUC7-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LUC7
Motif
Other DBs
NCBI-GeneID: 360503
NCBI-ProteinID: NP_001019440
RGD: 1307542
Ensembl: ENSRNOG00000020488
UniProt: A0A0G2QBZ8
Position
10q12
AA seq 272 aa AA seqDB search
MDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQE
EISAEVSAKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRSKKKEAEEEY
RNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLRKTVA
EKQEKRNQDRLRRREEREREERLGRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKFSRS
RSRDRYRRHRSRSRSHSRGHRRASRDRSTKYK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggatttaggagaatgtaccaaaatccacgacttggcccttcgagcagattatgaaatt
gcaagtaaagaaagagacctgttttttgaattagatgctatggatcacttagagtccttc
attgcagagtgtgatcggagaactgaacttgctaagaagcggctggctgaaacacaggag
gaaataagtgcagaagtttctgccaaggcagaaaaagtacatgaattaaatgaagaaata
ggaaaacttcttgctaaagctgagcagttaggagctgaaggaaatgtggatgaatcccag
aagattcttatggaagtggagaaggttcgctcaaagaaaaaagaagcagaggaagaatac
agaaattccatgcctgcatccagttttcaacagcaaaaactccgtgtttgcgaggtttgt
tcagcttatcttggtctccatgacaatgaccgtcgtcttgcagaccacttcggaggcaaa
ttacacttggggttcattcagatccgagagaagcttgatcagttgaggaaaactgtggct
gaaaaacaggaaaaaagaaatcaggatcgattgaggagaagagaggagagagagcgagaa
gagcgcctgggcaggcggtctggatcaagaacccgagatcggaggaggtcacgttcccgg
gatcgtcgaaggaggcggtctaggtctacctcccgagagcggcggaagttttcccgttcc
aggtcccgagatagataccggcgacatcgcagccgttcccggagccacagccggggtcac
cgacgggcttccagggaccggagtacaaaatacaagtaa

DBGET integrated database retrieval system