KEGG   Rattus norvegicus (rat): 360520
Entry
360520            CDS       T01003                                 

Gene name
Tbc1d9b, RGD1310147
Definition
(RefSeq) TBC1 domain family member 9B
  KO
K19951  TBC1 domain family member 8/9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360520 (Tbc1d9b)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    360520 (Tbc1d9b)
 Endosome - Golgi transport
  Rab GTPases and associated proteins
    360520 (Tbc1d9b)
SSDB
Motif
Pfam: RabGAP-TBC GRAM EF-hand_1 EF-hand_6 EF-hand_7
Other DBs
NCBI-GeneID: 360520
NCBI-ProteinID: NP_001101744
RGD: 1310147
Ensembl: ENSRNOG00000003050
UniProt: F1LRL4
Position
10q22
AA seq 1262 aa
MWLGPEEVLVANALWVTERANPFFVLQRRRGHGKGGGLTGLLVGTLDVVLDSSARVAPYR
ILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDNEEDITTFVKGKIHGIIA
EENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSFWKGRVPRQGWLYLTVN
HLCFYSFLLGKEVSLVVQWVDVTRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKL
MEQLANLAMRQLLDSEGFLEDKALPRPIRPHKNISALKRDLDARAKNECYRATFRLPKDE
RLDGHTGCTLWTPFNKLHIPGQMFISYNYICFASKEEDACRLIIPLREVTIVEKADSSSV
LPSPLSISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQTGSIAGGTKASVPDPAPES
LPTPQEASEPPTSPTSPLSSPLSFSTQEIPTTSQGLLKVFQKNSPMEDLGAKGAKEKMKE
ESWNIHFFEYGRGVCMYRTAKTRELVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELV
EKSMGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIV
TSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDVLPRLSEKMQE
LGVISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLDCSD
EGEAMTVLGRYLDNVVNKQSISPPIPHLHALLTSGDDPPAEVDIFDLLKVSYEKFSSLRA
DDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPGDIGFSIEELEDLYMVFKAKHLASQYWGG
NRSAAIHRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPVLAGRMFRLLDQNKDSLI
NFKEFVTGMSGMYHGDLTEKLKALYKLHLPPALIPEEAESALEAAHYFPEDSSSEASPLA
SDLDLFLPWEAQGLQEQQEGRGSEDIQERREEKETSPPDYRHYLRIWAKEKEAQKETIKD
LPKMNQEQFIELCKTLYNMFSEDPLEQDLYHAIATVASLLLRIGEVGKKFSALTTKKPRD
GAHSGDHNSATEEDEPPISKLHQDPARECQPPAAGDPQAKASGDMHLGKALQDSHVIVEG
GSGEGQGSPSLLLSDDETKDDMSMSSYSVVSTGSLPCEDLTEDTVLVGGEACSPTATSRM
GGTVDMDWCISFEQILASILTESVLVNFFEKRVDIGLKIKDQKKVERQFSTSSDHEPPGV
LG
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgtggctcggcccggaggaggtgctggtggccaacgcgctatgggtgacggagcgggcc
aaccccttcttcgtgctgcagcggcgccgaggccatggcaagggtggcggcctcacgggt
cttcttgtgggcaccctggatgtggtgctggactccagtgcccgtgtggccccctaccgc
atcctgcaccagacccaggactcacaggtctactggacggtggcatgtggttcttcccgc
aaagagatcaccaaacactgggagtggctggaaaacaacttacttcagacgctgtccatc
ttcgacaacgaggaggacatcactaccttcgtcaagggcaagatacacggcatcatcgca
gaagagaacaagaacctgcagccccagggggacgaggacccagggaaattcaaggaggca
gagctaaagatgcggaagcagttcggcatgccagagggagagaagctggtcaactactac
tcctgtagcttctggaagggccgagtgcctcggcagggctggctctacctgaccgtcaac
cacctgtgtttctactccttcttgctggggaaggaagtgagcctggtggtacagtgggtg
gacgttacacgcttggagaagaatgccactttactcttccccgagagcatccgtgtggac
acgcgggaccaggagctattcttctccatgttcctaaacattggtgagaccttcaagctc
atggaacagctggccaacctggccatgcgacaactgctggacagcgagggcttcctggag
gacaaggccctgcccaggcctatccggccacataagaacatctcagctctaaagcgagac
ctggatgcccgagctaagaacgagtgctacagggccacgttccggctcccaaaagatgaa
cggctggatggacacacaggttgcaccctgtggacaccatttaacaagctacacatcccc
ggccagatgttcatctcctataactacatctgctttgccagcaaagaggaagatgcgtgc
cgcctcatcatacccctgagggaggtgaccattgttgagaaagctgacagctccagtgtc
ctgcccagccctctgtctatcagcactaagagtaaaatgaccttcttgtttgccaacctg
aaagaccgtgacttcctggttcagaggatctctgacttcctccagaaaacaccgtccaaa
cagacaggcagcatcgctgggggaacaaaggccagtgttccagacccagccccagagtct
ctcccaactcctcaggaggcatcagagccacccaccagcccaacctctcccctaagcagc
cctctgagtttcagtacacaggagattcctactacttcccagggcctgctcaaagtcttc
cagaagaactcacccatggaggacctcggcgccaaaggggccaaggagaagatgaaggaa
gagtcctggaacatccacttctttgagtacgggcgtggcgtgtgcatgtaccgaacagcc
aaaactcgggagctggtcctgaaaggcatccccgagagcctccgaggggagctttggctc
ctcttctcgggggcctggaatgagatggtgacccatcctggctactacgctgagctagta
gagaagtccatggggaagtacagcttggccaccgaagagatcgagcgggacctccatcgc
tccatgcctgagcaccctgccttccagaacgagctggggatcgctgcactccggcgggtg
ctgaccgcctacgccttccgaaacccgactattggctactgccaggcaatgaacatcgtg
acctcggtgctcctgctctatggcagtgaggaagaagccttctggctactggtggccctg
tgtgagcgcatgctgcccgactactacaataccagagtagtgggggccctcgtagaccaa
ggtatctttgaagagctcacaagagacgtcctgccccggctctcagagaagatgcaggag
ctgggggtgatctccagcatctcgctgtcctggttcctgaccctcttcctcagcgtcatg
ccctttgagagcgcagtggttattgttgactgctttttctacgagggcatcaaagtgata
ctgcaggtggccttggctgtgctggacgccaacatggaacagctgctggactgcagtgac
gagggcgaggccatgaccgtgctgggcaggtacctggacaatgtggtcaacaagcagagc
atttctccacctatcccacacctccatgctctgctgaccagtggagatgaccctcctgca
gaggtggacatctttgacctcctgaaagtgtcttatgagaagttcagcagcctgagggct
gacgacattgaacagatgcggtttaaacagaggctgaaggtgatccagtccttggaagac
acagccaagagaagcgtggtccgggccataccaggggacattggcttctccatcgaagag
ctggaggatctttacatggtgtttaaggccaagcatctggcaagccagtactggggtggt
aaccgctcagcagccatccaccgagaccccagcctgccctacctggagcagtaccggatc
gatgccagccagtttcgggagctctttgccagcctgacgccttgggcctgtggctctcac
acgcctgtcttggcaggccgcatgttccgcctcctggaccaaaacaaggactcactgatc
aacttcaaggagtttgtgacagggatgagtgggatgtaccatggagacctcacagagaag
ctcaaagcgctctacaagctgcacctgcccccagctctgatcccagaggaagcggagtca
gccctggaggccgcccattatttcccagaggatagctcctcagaagcatctcctctggcc
tcagatctggatcttttcctgccttgggaggctcaaggactgcaggagcagcaggaagga
agaggaagtgaggacatccaggaaaggagagaggagaaggagaccagcccccctgactac
cgacactaccttcgaatatgggctaaggagaaagaggctcagaaggaaaccatcaaggac
cttcccaagatgaaccaggagcaattcattgagctgtgtaaaacactttacaacatgttt
agcgaagaccctttggaacaggacttgtaccatgccatcgccactgtggccagccttctc
ctccgcattggtgaggtggggaagaagttttcggccctgaccaccaagaagcccagggat
ggtgcccacagtggggatcacaacagtgccacagaagaggatgagccacccatatccaaa
ctccatcaggacccagcacgggaatgccagccaccagctgcaggggatccgcaggccaaa
gccagtggcgacatgcatcttgggaaagcattgcaggacagtcacgtgatagtggaggga
ggcagcggcgaggggcagggctctccttccctgcttttgtctgatgatgaaaccaaagat
gacatgtccatgtcctcctactcagtagtcagcacggggtccctgccgtgcgaggacctc
acagaagacacagtgctggtgggaggagaagcctgcagccccactgccacctcacggatg
ggaggcaccgtggacatggattggtgcatttccttcgagcagatcctggcctccatcctg
acagagtctgtgctagtgaacttctttgagaagagggtagacattggactcaagatcaaa
gaccagaagaaagtcgaaaggcagttcagcacctccagtgaccatgagccccctggggtc
ttgggctga

DBGET integrated database retrieval system