KEGG   Rattus norvegicus (rat): 360537Help
Entry
360537            CDS       T01003                                 

Gene name
Tom1l2
Definition
(RefSeq) target of myb1 like 2 membrane trafficking protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: GAT
Motif
Other DBs
NCBI-GeneID: 360537
NCBI-ProteinID: NP_001101747
RGD: 1306728
Ensembl: ENSRNOG00000003590
UniProt: D4A6C9
Position
10q22
AA seq 284 aa AA seqDB search
MADLDALSPIHTPQRSVPEMDPAATIPRSQLQPRTTAGSYSSPPAAPYSTLQAPALSVTG
PITANSEQIARLRSELDIVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQHRI
VELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLSEVTEDNLID
LGPGSPAVVSPMVGSTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCKPQDGFDMFAQTRG
NSLAEQRKTVTYEDPQAVGGLASALDNRKQSSEMEMYGNACLSA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcagacttggacgctctgtctcctatccacacaccccagcggagtgtcccagaaatg
gatccagctgccaccattcccaggtcccagttacagcccaggacaactgctggctcgtat
tcttcacctcctgcagctccctactctactctacaggccccggctctgagtgtgacgggc
cccatcacagccaattcagaacagattgctaggctgcgcagtgagctggacattgttcgg
ggaaacacaaaagtcatgtctgagatgttaacagaaatggtccctgggcaggaggattct
tctgatctggaactactacaggagttgaacagaacctgccgagccatgcagcaccgcata
gtggagctcatctcccgagtgtccaatgaggaggtcaccgaggagctgctgcacgtcaac
gatgacctcaacaatgtcttcctccgctatgagaggttcgagaggtaccggtctggccga
tccgttcagaatgccagcaatggagtactaagtgaagttactgaagacaacttaatagac
ctgggcccaggctctcccgctgtggtgagccccatggtgggaagcacggcacccccatct
tctctctcctcccaactcgcaggcttggacttggggacagagagtgtcagtggcaccctc
agttcacttcagcagtgcaagccacaagatggttttgacatgtttgcccagaccagagga
aactccttggctgaacagcgaaagacggtcacctatgaggatccccaggctgttggagga
ctcgcttctgcactagacaatcggaaacagagctcagaaatggaaatgtatgggaatgca
tgcctgtctgcctag

DBGET integrated database retrieval system