KEGG   Rattus norvegicus (rat): 360540
Entry
360540            CDS       T01003                                 

Gene name
Akap10, D-akap2
Definition
(RefSeq) A-kinase anchoring protein 10
  KO
K16526  A-kinase anchor protein 10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360540 (Akap10)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    360540 (Akap10)
SSDB
Motif
Pfam: RGS
Other DBs
NCBI-GeneID: 360540
NCBI-ProteinID: NP_001108078
RGD: 1308869
Ensembl: ENSRNOG00000002899
UniProt: F1LNB3
Position
10q22
AA seq 662 aa
MRGAGPSPRHSPRALRPDPGPAMSFFRRKVKGKEQEKNLDVKSIKASIAVHSPQKSTKNH
ALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKS
SLSKTLEQVLRDSVVLPYFLQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVKQS
SLAEPVSPSKKQETTASFVTESLDRRLGDSSSAPLLLTQSEGTDLSSRTQNTQNHLLLSQ
ECHSTHSLHHEVARTGTHQISTDSQESSSRLAVASRNSCSSPLRELSEKLMKSIEQDAVN
TFTKYISPDAAKPIPITEAMRNDIIAKICGEDGQVDPNCFVLAQAVVFSAMEQEHFSEFL
RSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLA
AKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPL
RQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLAAHGSVCLPEESHSGG
SDGSTAQSSVKKASIKILKNFDEAIVVDAASLDPESLYQRTYAGKMSFGRVSDLGQFIRE
SEPEPDVKKSKGFMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDVMQQAHHDQPLEKST
KL
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgaggggagccgggccctccccgcgacactccccccgcgccctccgccccgacccgggc
cccgccatgtccttcttccggcggaaagtgaaaggtaaagagcaagagaagaacttagat
gtcaaatccattaaagcttcaatagccgtacattccccacaaaaaagcactaaaaatcat
gccttgctggaagctgcaggaccaagtcatgttgcaatcaatgccatttctgccaacatg
gactctttttcaagtagcaggacagcaacgcttaagaaacagccaagccacatggaggct
gctcattttggagacttgggcagatcctgtctggactatcaaactcaagagaccaaatcc
agtctttcaaagacccttgaacaagtcttacgtgacagtgttgtccttccatatttcctt
cagtttatggaacttcggagaatggagcacctggtgaaattttggttagaggctgaaagt
tttcactctacaacttggtcccgaataagagcacacagtctaaacacagtgaaacagagt
tcactggctgagcctgtctctccatctaaaaaacaggaaacgacagcgtcttttgtaact
gagtctcttgacaggaggttgggagattctagctcagccccactacttttgactcaatca
gaaggaactgacctgagtagtagaactcagaacactcagaatcacttgctgctttcccag
gaatgccacagtacccattctctccatcatgaagtggccagaacaggaactcatcagatt
tccactgactcccaagaatcctcttccagacttgcagtagccagtagaaacagttgctct
tctccactgagagaactgtcagaaaaactaatgaaaagtatagaacaagatgcagtgaat
acttttaccaaatatatctctccagatgctgctaaaccaataccaattacagaagccatg
agaaacgacatcatagcaaagatttgtggagaagatggacaggtggatcccaactgtttc
gttctggcacaggctgtagtctttagtgcaatggagcaagagcactttagtgagtttctg
cgaagtcaccatttctgtaaataccagattgaagtgctgaccagtgggactgtttacctg
gctgatattctcttctgtgagtcagccctcttttatttttctgagtacatggaaaaagaa
gatgcagtgaatatcttacaattctggttggcagcggataatttccagtctcagcttgct
gccaaaaagggccagtatgatgggcaggaggcacagaatgatgccatgattttatatgac
aagtacttttccctccaagccacacacccccttggatttgatgatgttgtgcgattagaa
atcgaatctaatatctgcagggaaggtgggccacttcctaactgtttcacaaccccatta
cgtcaggcctggacaaccatggagaaggtctttttgcctggttttctgtccagcaatctt
tattacaaatatttgaatgatctcatccactcagttcgaggagatgagtttctgggaggg
aatgtctcattggctgctcatggctctgtctgccttcctgaggagtctcactcaggcggc
tccgatggctccactgctcagtctagtgtgaaaaaagccagtattaaaattctgaaaaac
tttgatgaagcaatagttgtggatgctgcaagcctggatccagaatctttatatcaacgg
acatacgccgggaagatgtcctttgggagagttagtgacttggggcagttcatccgagag
tctgagcctgaacctgatgtgaagaaatcgaaaggattcatgttctcacaagctatgaag
aagtgggtgcaaggaaatactgatgaggcccaagaagagctagcttggaagattgcaaaa
atgatagtgagtgatgttatgcagcaggcacaccatgatcaaccactagagaagtctaca
aagctatga

DBGET integrated database retrieval system