KEGG   Rattus norvegicus (rat): 360546
Entry
360546            CDS       T01003                                 

Gene name
Efnb3, ELK-L3
Definition
(RefSeq) ephrin B3
  KO
K05463  ephrin-B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    360546 (Efnb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    360546 (Efnb3)
   04052 Cytokines and growth factors [BR:rno04052]
    360546 (Efnb3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   360546 (Efnb3)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   360546 (Efnb3)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 360546
NCBI-ProteinID: NP_001094450
RGD: 2541
Ensembl: ENSRNOG00000010320
UniProt: G3V7D4
Position
10q24
AA seq 340 aa
MGGPHFGPGGVQVGALLLLGFAGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDL
LCPRARPPGPHSSPSYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEY
SPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKP
VSEMPMERDRGAAHSQEPGKDSIPGDPNSNATSRGAEGPLPPPSMPAVAGAAGGLALLLL
GVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGELGIALRGG
GAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggggggcccccattttgggccagggggtgtgcaagtcggggccctgctgctgttaggt
tttgcggggctggtgtctggactcagcctggagcctgtctactggaactcggcgaataag
aggttccaggcagagggtggttacgtgctttaccctcagatcggggaccggctagatcta
ctttgtccccgggcccggcctcctggcccccactcctctcctagttatgagttctacaaa
ctgtacctggtagggggtgcccagggtcggcgttgtgaggcaccccctgccccaaacctt
cttctcacatgtgaccggccagacctggacctccgcttcaccatcaagttccaggaatac
agccctaacctctggggccacgagttcagatcccaccacgattactacataattgccaca
tcagatgggacccgggaaggcctggagagcttgcagggaggtgtgtgcctaaccagaggc
atgaaggtgcttctgcgagtgggacaaagtccccgaggaggagctgtaccccgaaaacct
gtgtctgaaatgcccatggagagagaccgaggggcagctcacagccaggagcctgggaag
gacagcataccaggtgaccccaacagcaatgcaacctcccggggtgctgaaggccccctg
ccccctcccagcatgcccgcggtggctggggcagcaggggggctggcgctgctcttgctg
ggcgtggcaggggctgggggtgccatgtgttggcggagacggcgggccaagccttcggag
agtcgccaccctggtcctggctcctttgggagaggagggtctctgggcctgggtggtgga
ggggggatgggacctcgggaggctgagcctggggagctaggaatagccctgcggggtggt
ggggctgcagatccccccttctgccctcactatgagaaggtgagtggtgactacggacac
cctgtgtacattgtgcaggatggccccccccagagccctccaaacatctactacaaggta
tga

DBGET integrated database retrieval system