KEGG   Rattus norvegicus (rat): 360549Help
Entry
360549            CDS       T01003                                 

Gene name
Plscr3, Pls3
Definition
(RefSeq) phospholipid scramblase 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Scramblase
Motif
Other DBs
NCBI-GeneID: 360549
NCBI-ProteinID: NP_001012139
RGD: 1307016
Ensembl: ENSRNOG00000027914
Vega: OTTRNOG00000002150
UniProt: Q6QBQ4
Position
10q24
AA seq 296 aa AA seqDB search
MAGYLPPKGYAPSPPPPYPVPAGYPEAAALHPGPGQAPVPTQGPAPAPGFSLFPSPGPVV
PGPPGPFVPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGTGQQLGQA
AEESNCCARLCCGARRPLRIRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTT
IGHVLQTWHPFIPKFSILDADRQPVLRVVGPCCTCGCGTDTNFEVKTKDESRSVGRISKQ
WGGLLREALTDADDFGLQFPVDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctacttgccccccaaaggttatgccccttcgcccccacctccctaccccgtg
ccagctgggtatccagaggcggcggcgctgcatcctggacccggacaggctccagtgccc
acccaggggcctgcccctgcgcctggcttctctctcttcccctcgccaggcccggtggtc
ccagggcctcctggtcccttcgtgccattgccaggggtgccttctggcctggaattccta
gtgcagattgatcaaatcttgattcatcagaaggctgagcgagtggaaacgttcctaggc
tgggagacctgtaataggtatgaacttcgctccgggaccggacagcaactgggtcaggca
gctgaggagagcaactgctgtgcccggctgtgctgtggtgcccgccggccgcttcgtatc
cgcctagcggaccccggggaccgcgaggtgctccgcctcctccgcccacttcactgcggc
tgcagctgctgtccttgtggtcttcaggagatggaagtccaggccccacctggcaccacc
attggccatgtgctacagacctggcaccccttcattcccaagttttccatcctggatgca
gatcgccaacctgttctacgagtcgtagggccttgctgcacttgtggctgtgggacggac
accaactttgaggtgaagacaaaggatgaatctcgaagtgtgggccgcatcagcaagcag
tggggagggctgctccgagaagccctcacagatgcggatgactttggcctccagttccca
gtagatctagatgtgagagtgaaggcggtgctgctgggagccacgttcctcattgattat
atgttcttcgagaagcgaggaggtgctggaccctctgccatcaccagttag

DBGET integrated database retrieval system