KEGG   Rattus norvegicus (rat): 360550Help
Entry
360550            CDS       T01003                                 

Gene name
Phf23
Definition
(RefSeq) PHD finger protein 23
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PHD PHD_2 C1_1 TFIIE-A_C Myc_N
Motif
Other DBs
NCBI-GeneID: 360550
NCBI-ProteinID: NP_001004272
RGD: 1302969
Ensembl: ENSRNOG00000017657
UniProt: Q6AY75
Position
10q24
AA seq 334 aa AA seqDB search
MLEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPPSKGAPDSATL
LEKMKLKDSLFDLDGPKVASPLSPTSLTSRPPAALTPVPLSQGDLSQPRKKDRKNRKLGP
GGGAGFGVLRRPRPAPGDGEKRSRIKKSKKRKLKKADRGDRLPPPGPPRAPPSDTDSEEE
EEEEEEEDDEEETTVVGGGGVPAPVLPTPPEAPRPPVTVHPEGAPPTDSEGKDAGSTETS
QDGDGSSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPFAGRPMIECSLCGTWIHLSCAK
IKKTNVPDFFYCQKCKELRPEARRLGGLPKSGEP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagccatggcggagcccagtcccgaagatccgcctccgactcttaagcccgag
actcagccaccggagaagcggcggagaacaattgaggatttcaacaaattctgcagtttt
gtcttggcctatgctggttacatcccccctagcaaaggggcccctgatagtgctactctg
cttgagaagatgaagctcaaggactctctgtttgatctggatgggcccaaagtggcatct
ccactgtctcccacatcgttgacctcccggcctcctgctgctctcaccccagtgccactg
tcccagggggacctctcccagcctcgaaagaaggaccgaaagaatagaaagttgggacca
ggaggtggggctggctttggggtgcttcggagacctcggccagctcctggggatggggaa
aaacggtctcgaatcaagaagagcaagaagcggaagttgaaaaaggccgaccggggggat
agactcccacctcctggccctcctagggctcctcccagtgatacagactctgaagaggag
gaggaagaggaagaagaggaagacgatgaggaagagacgacagtggtgggtggtggtgga
gttccagcccctgtgctcccaacaccccctgaagcccccaggccccctgttacagtgcac
cctgaaggggctccccctactgacagtgaaggcaaagatgcgggcagcacagaaacaagc
caagatggagatggcagctccagtgaaggagagatgcgggtcatggatgaggacatcatg
gtagaatcaggtgatgactcatgggatctgatcacatgttactgcagaaagccctttgct
gggcggcccatgatcgagtgcagcctctgtgggacatggatccacctctcctgtgctaag
attaagaagaccaatgttcctgacttcttttattgccagaaatgcaaggaacttcggcca
gaggcccggcggttagggggtcttcccaaatctggagaaccctga

DBGET integrated database retrieval system