KEGG   Rattus norvegicus (rat): 360565
Entry
360565            CDS       T01003                                 

Gene name
Spata22, RGD1565378, Sgn
Definition
(RefSeq) spermatogenesis associated 22
  KO
K22421  spermatogenesis-associated protein 22
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    360565 (Spata22)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     360565 (Spata22)
SSDB
Motif
Pfam: KLRAQ
Other DBs
NCBI-GeneID: 360565
NCBI-ProteinID: NP_001178753
RGD: 1565378
Ensembl: ENSRNOG00000037307
UniProt: D3ZKY9
Position
10q24
AA seq 361 aa
MKRNLNESSTRSTAGCLPVPLFNQKKRNRQPLTSNPLQSDPGIGTVSDTYGFPSLPTDWA
WEAVNPVVAPLKKTVNTGQIPASASYPLRIEDPVCKSIESNAKRSQGGGGYRGNNRNTSS
RTWDRNDFRPQHKTVSPAANSEFSSGPVNLGAQRQKQFQTPEFPNLPGHKEAEVPRQTYL
SKLPGSTMKGPDRASALQAFKPSFQQNPFNKTVLGDVPRENSLKETTLYQLKEKDNSLRI
ISAVIESMKYWQAQVKKTVLLFEVLAVLDSAVTPGPHYSKTFLMRDGKNILPCVFYEIDR
ELPRLIRGRVHRCVGHYDPHKNIFKCVSVRPASASEQKTFQAFVTIVDAEMKYHTKVMNE
M
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaagagaaacttaaatgaaagttcaactcgaagtacagcaggctgtttgcctgtgccg
ttgttcaatcagaaaaagaggaacagacagccattaacgtctaatccacttcagagtgat
ccaggaattggtactgtttctgacacttatggtttcccatctctaccaacagattgggcg
tgggaagctgtgaatccagtggtggctcctttaaagaaaacagtgaatacagggcaaata
ccagcttctgcttcttatcccctgagaattgaagatcctgtgtgtaaatctattgagtca
aacgctaaaagaagccaaggtggcgggggatacagaggcaacaacagaaacactagctct
agaacttgggatagaaatgatttccgacctcagcataaaactgtaagccctgcggcaaac
agtgagttcagttctggtccagtgaatttgggagctcaacgacaaaaacagttccaaaca
cctgaatttcctaacttacctggacacaaagaagctgaagttccccgacagacatattta
tcaaaactgcctggctctacaatgaaaggtccagacagagccagcgcactgcaggcattt
aaaccaagttttcaacaaaatccatttaataaaacagtgttgggagatgttccaagagaa
aattctctgaaggaaactaccttgtatcagttaaaggaaaaagataattctttaagaatt
atttctgcagttattgagagcatgaagtattggcaagcacaagtgaagaaaactgtactt
ctttttgaagtattggctgtcctggattcggctgtcacgcctggcccacattattcaaag
acttttcttatgagagatgggaaaaatattcttccatgtgtattttatgaaattgatcgt
gaacttccaagactgattagaggccgagttcacaggtgtgttgggcactatgacccacac
aagaacattttcaagtgtgtttctgtcagaccagcatctgcttctgaacaaaagactttt
caagcatttgttacaattgtagatgccgagatgaaatatcatactaaagtaatgaatgaa
atgtaa

DBGET integrated database retrieval system