KEGG   Rattus norvegicus (rat): 360569
Entry
360569            CDS       T01003                                 

Gene name
Mrm3, RGD1309077, Rnmtl1
Definition
(RefSeq) mitochondrial rRNA methyltransferase 3
  KO
K20095  16S rRNA (guanosine(1370)-2'-O)-methyltransferase [EC:2.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    360569 (Mrm3)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     360569 (Mrm3)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   360569 (Mrm3)
SSDB
Motif
Pfam: SpoU_methylase SpoU_sub_bind
Other DBs
NCBI-GeneID: 360569
NCBI-ProteinID: NP_001101752
RGD: 1309077
Ensembl: ENSRNOG00000037238
UniProt: D3ZQG0
Position
10q24
AA seq 418 aa
MAAPAKGMWYSLGPLLRVVQTRDLDARRWVRALRRSPVRVLFPSGQVEERKRAPDKQPRK
AVPEASSQGQQQKQPLETSPSQTPHTWEEAGLRYDKACPGDRRLSSVMTIVKSRPFREKQ
GKILLEGRRLIADALKAGAVPKMFFFSRLEYIKELPVDKLKGVSLIKVKFEDIKDWSDLV
TPQGIMGIFAKPDPVKMTYPETQLHHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLL
TKGCVDAWEPKVLRAGMGAHFQVPIVNNVEWETVPNHLPPDTRVYVADNCGLYAQVQMSN
KTGDRDWACDRRFLKFHKNEVDLDTKARKDWLPKLEVQSYDLDWTEAPAALVIGGETHGV
SLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQLRIKMGDLSRDSCCH
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcagcgccggcgaagggcatgtggtattccctgggaccattgctgcgggtggtccag
actcgggacctcgacgctcggcgctgggtccgggcgctgcggcgaagcccggtgagagtg
ttgtttccctcgggacaggtggaggaacggaagcgtgctcctgataagcagccccgcaag
gcggtccctgaggccagttcccagggacagcaacagaaacaacctcttgagacatcccca
tcccagacccctcacacctgggaagaggcagggcttcgctacgataaggcctgtcccggg
gacaggaggctaagcagtgtgatgacaatagttaagtccaggccttttcgggaaaagcaa
gggaagatcctactggaaggtcgcaggctgattgcagatgctctcaaggctggagctgtg
ccaaaaatgttcttttttagccgactggagtacatcaaggagttgccagtagataagctg
aaaggtgtcagcctcattaaggtgaaatttgaggatatcaaggattggtcggacctggta
acgccacaaggaataatggggatttttgccaaacctgaccctgttaagatgacgtatcca
gagactcagcttcaccattcactgcccttactgttgatttgtgacaatctccgtgaccct
gggaacctggggacaatcctgagatctgcagctggagcaggctgcagtaaagtcttactc
accaaaggctgtgtggatgcctgggaacctaaagtgctccgggcaggcatgggggcacat
ttccaggtgcccattgtgaacaatgtggaatgggagacagtgcccaatcacttgccccct
gacacccgagtctatgtggcagacaactgtggcctctatgcccaggttcagatgtctaat
aaaaccggtgaccgtgactgggcatgtgatcgccgattcttaaagttccataagaatgaa
gtggacctagacactaaagccagaaaagactggcttcccaaacttgaggtccagagttat
gatctggactggactgaagcaccagcagctctggtgataggcggagagacgcatggggta
agcctggagtccctgcaattggccgagagtactggtggcaagagactgctgatccctgtt
gtacctggtgtggacagtctgaattcagccatggctgcgagcatcctgctctttgaaggg
aaaaggcagctgaggataaagatgggagacttgagcagggacagttgttgccattga

DBGET integrated database retrieval system