KEGG   Rattus norvegicus (rat): 360592Help
Entry
360592            CDS       T01003                                 

Gene name
Trim37
Definition
(RefSeq) tripartite motif-containing 37
  KO
K10608  tripartite motif-containing protein 37 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    360592 (Trim37)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    360592 (Trim37)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     360592 (Trim37)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    360592 (Trim37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-B_box MATH zf-C3HC4_3 zf-C3HC4_2 HlyD_2 MRFAP1 FUSC PIN_8 DUF148
Motif
Other DBs
NCBI-GeneID: 360592
NCBI-ProteinID: NP_001101758
RGD: 1308349
Ensembl: ENSRNOG00000006248
UniProt: D3ZL82
Position
10q26
AA seq 1008 aa AA seqDB search
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQL
RELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALW
GGMHGGHTFKPLAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVR
EIRNAVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK
SAEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQRADPVYSPP
LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSCNDPTKNII
REFASDFEVGECWGYNRFFRLDLLANEGYLNRQNDTVILRFQVRSPTFFQKCRDQHWYIT
QLEAAQTGYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDTPETRAKKAGSCSD
MLLEGGPTSASVRETKEDEDEEEKIQNEDYHHELSDGDLDLDLVGEDEVNHLDGSSSSAS
STATSNTEENDIDEETMSGENDVEYNSMELEEGELMEDAAAAGPPGSSHSYVGASSRMSR
RAHLCSAATSSLLDIDPLILIHLLDLKDRSSMENLWGLQPRPSASLLQPTASYSRKDKDQ
RKQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKTTLADIKGSSVASADLQTNLFCADQA
ALATCGPENSGRLQDLGMELLAKSSVAGCYIRNPTNKKNSPKSARAIAGSLSLRRAVDSG
ENSRSKGDCQALSEGSPGSSQSGSRHSSPRALTHGIIGDLLPKSEDRQCKALDSDAVVVA
VFNGLPTVEKRRKMVTLGTNVKGGRLEGMQLADLESPSDAGEVQPTLPEGASAAPEEGMS
SDSDIECDTENEEQEEHTSMGAFNDPFLAQPPDEDSHSSFPDGEQIDPENLHFNTDEGSG
RLLVLGTQQPYCEEVQTSQPGETACTGSHGYELRPLAPANSHHQLPDV
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcagagtgtggagagcattgctgaggttttccgatgcttcatttgtatggag
aaattgcgggatgcccgactgtgtcctcactgctccaagctctgttgtttcagctgtatt
aggcgctggctgacagagcagagagctcagtgtcctcattgtcgtgctccactccagcta
cgggaacttgtaaattgtcgctgggcggaagaggtgacacagcagctggatactctccag
ctgtgtagtctcaccaaacatgaagaaaatgagaaagacaaatgtgaaaatcaccatgaa
aaacttagtgtgttttgctggacttgtaagaagtgtatctgccatcagtgtgcactttgg
ggaggaatgcatggtggacacacgtttaaacctttggcagaaatctatgaacagcatgtc
actaaagtgaacgaagaggtagccaaacttcgtcgacgtctcatggaactgatcagctta
gttcaagaagtggaaagaaatgtagaagcggtgagaaatgcgaaggacgaacgtgttcgg
gaaatcaggaacgcggtggagatgatgattgcacggctggacacacagctgaagaacaag
ctcataaccctcatgggtcagaagacgtctcttactcaagaaacagagctgttggaatct
ttacttcaggaggtagaacatcagttgcggtcttgcagtaagagtgagctgatctccaag
agcgcagagatcctaatgatgttccagcaagttcaccgaaagcccatggcttcctttgtt
accacacctgtcccaccagactttaccagtgaattggtaccatcttatgattcagctact
tttgttttagagaacttcagcactttgcggcagagagcagatccggtttacagcccgcct
cttcaagtttcaggactttgctggaggttaaaagtttacccagatggaaatggagttgta
cgtggctattatttatctgtatttttggaactatcggctggcttacctgaaacttccaag
tatgaatatcgtgtagaaatggttcatcagtcctgcaacgatcctactaaaaatatcatt
cgagaatttgcatctgactttgaagttggagaatgctggggctacaatagatttttccgt
ttggacttacttgcaaatgaaggatacttgaaccgacaaaatgatacagtgattttaagg
tttcaggtgcgctcaccaacattttttcaaaaatgccgggatcagcactggtacattact
caattggaagctgcacagacaggttatattcaacaaataaacaatcttaaagagagattg
actattgaactgtcccgaactcagaaatccagagatctgtcaccaccagataatcatctt
agcccccaaaatgatgatactcccgagacacgagctaagaaagctgggtcatgctctgac
atgcttctggaaggtggtcctacttcagcttctgtaagggagaccaaggaagatgaagat
gaggaggagaagattcagaatgaagactatcatcatgagctctcagatggagatctggat
ctggatcttgtcggtgaagatgaagtgaatcacctggacggcagcagctcttctgctagt
tctacagcaacaagcaacacggaagaaaacgatatcgatgaggagaccatgtctggagag
aatgatgtagaatataacagcatggagctggaggagggagagctcatggaagacgcagcc
gcggcggggcctccaggcagtagccacagctatgtgggtgccagtagcagaatgtcaaga
agagcacatttatgctctgcagctaccagtagcttattagacattgatcctttaatccta
atacatttactggatcttaaggaccggagcagtatggaaaatctgtggggtttacagcct
cgtccatctgcttcacttttgcaacccacagcgtcatattctcgaaaagataaagatcaa
aggaagcagcaggcgatgtggcgagtgccctctgacctaaagatgctgaaaaggctcaaa
acacaaatggctgaagttcggtgtatgaagactgatgtgaagactacactggcagatata
aagggcagcagtgttgcttctgcagacttgcagacaaaccttttctgtgctgaccaggca
gctctggctacctgtggacctgaaaactctggtagattgcaggatttgggcatggagctt
ctggcaaagtcgtcagttgctggctgttacataagaaaccccacaaataagaagaattca
cccaagtcagctcgggccatagcaggcagtctgtcactccgaagagctgtagactctgga
gaaaacagccgttcaaagggagactgtcaggctttgtctgaaggctccccaggaagctct
cagtctgggagccgacacagctccccccgggctctgacacatggcatcattggggacctt
ctgcccaaaagtgaagaccgacagtgcaaagctttggattctgatgctgtggtggttgca
gttttcaatggtttacctactgttgagaaaagaaggaaaatggtcactctggggactaat
gtaaaaggaggtcgtctggaaggaatgcaattggcagatttggaaagtccttctgatgct
ggggaggtacagcccacactacctgaaggagcctcagctgcccctgaggaaggaatgagt
agtgacagcgacattgaatgtgacactgagaacgaggagcaggaagagcacaccagcatg
ggtgccttcaacgatccgttcctggcccagcctccggatgaagattcgcattccagtttt
cctgatggtgaacaaatagaccctgaaaatctccacttcaacaccgatgaaggcagtgga
agactgcttgttcttggaacccagcagccatactgtgaggaagtccaaaccagccagcct
ggggagactgcatgtacagggtcacacgggtatgagctgagacctctggccccagctaac
agccaccatcagctgcctgacgtgtaa

DBGET integrated database retrieval system