KEGG   Rattus norvegicus (rat): 360606Help
Entry
360606            CDS       T01003                                 

Gene name
Itga3
Definition
(RefSeq) integrin subunit alpha 3
  KO
K06482  integrin alpha 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    360606 (Itga3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    360606 (Itga3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    360606 (Itga3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    360606 (Itga3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    360606 (Itga3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    360606 (Itga3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    360606 (Itga3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    360606 (Itga3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    360606 (Itga3)
   05414 Dilated cardiomyopathy (DCM)
    360606 (Itga3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    360606 (Itga3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    360606 (Itga3)
   04515 Cell adhesion molecules [BR:rno04515]
    360606 (Itga3)
   04090 CD molecules [BR:rno04090]
    360606 (Itga3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   360606 (Itga3)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   360606 (Itga3)
CD molecules [BR:rno04090]
 Proteins
  360606 (Itga3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N
Motif
Other DBs
NCBI-GeneID: 360606
NCBI-ProteinID: XP_003750955
RGD: 1310333
Ensembl: ENSRNOG00000004276
UniProt: D3ZCG9
Position
10q26
AA seq 1052 aa AA seqDB search
MGPGPRRVPRDPGWMLRALALMVAASGRVAFAFNLDTKFLVVKEAVNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVDDDYTNRTGAVYLCPLTALKNDCERMDISEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTY
HNEMCNSNTDYLQTGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYR
GSEDQGNLYIGYTMQVGSAILHPSEITLVTGAPRHQHMGAVFLLKQESGGDLQRRQVLKG
TQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGTSFPDQPSLL
LHGPSRSAFGISVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSGGLLKQPQQIIHGE
TLGLPGLATFGYSLSGKMDVDENLYPDLLVGSLSDHIVLLRARPVINILHRTLVARPAVL
DPSLCTVTSCVQVELCFAYNQSAGNPNYRRNITLAYTVEADRDRRPPRLRFARSQSSVFH
GFFSMPETHCQTLELLLMDNVRDKLRPIVITMNYSLPLRMPDRLKLGLRSLDAYPVLNQA
QAMENHTEVHFQKECGPDNKCDSNLQMRAAFVSEQLQPLSRLQYSRDTKKLFLSINVTNS
PSRQRAGEDAHEALLTLEVSSALLLSSVRPAGTCQANETNTVCELGNPFKRNQRMELLIA
FEVTGVTLHTRDLRAHLQLSTSSHQDNLQPMFLTLQVDYTLQASLSLMNHRLQSFFSGTV
MGEAAMKTVKDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEVTNGKWLLYPTEITIH
SNGSWPCQPHGNLVNPLNLTLSDPGVKPLSPQRRRRQLDPGGDQGPPPVTLAAAKKAKSE
TVLTCSNGRARCVWLECPLPDASNITNVTVKARVWNSTFIEDYKDFDRVRVDGWATLFLR
TSIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIIILLWKCGFF
KRARTRALYEAKRQKAEMRSQPSETERLTDDY
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgggccctggcccgcgccgcgtgccccgcgaccctggctggatgctccgcgccctggct
ttgatggtggcggctagtggccgggtcgccttcgctttcaacctggacaccaaattcctg
gtggtgaaggaggcggtgaaccctggtagcctctttggctactccgtcgccctccatcgg
cagactgagcgacagcagcgctacctccttctggccggtgcaccccgagacctcgcagtg
gatgatgactacaccaaccggactggtgctgtgtacctgtgtcccctcactgccctcaag
aacgattgtgaacgcatggacatttcagagaagagtgaccctgaccatcacattattgag
gacatgtggcttggagtgactgtggccagccagggccctgcaggtagagtcctggtctgt
gcccatcggtacaccaaggtgctgtggtctgggctggaagaccagcggcgcatggtgggc
aagtgctacgtgcgtggcaacgacctacagctcgaccctggcgatgattggcagacatac
cacaacgagatgtgtaacagcaacactgactacttgcagactggcatgtgccagctgggc
accagtggcggcttcacccagaacactgtatacttcggcgcccctggtgcctacaactgg
aaaggaaacagctacatgattcagcggaaagactgggatttatctgaatacagctacagg
ggctcagaggaccagggaaacctctatattgggtacacgatgcaggtaggcagtgccatc
ctacatccctcggagatcactcttgtgacgggtgccccacggcaccaacatatgggcgct
gtcttcttgctgaaacaagagtcgggtggagacctgcagaggaggcaggtgctgaagggc
acgcaggtgggcgcttattttggcagtgccattgccctggcagacctgaacaatgatggg
tggcaggacctcctggtgggtgctccctactacttcgaacggaaagaggaggtagggggt
gccgtctatgtcttcatgaaccaggcgggaacgtccttccctgatcagccttccctcctg
ctccatggccccagtcgctctgcctttggcatctctgtagccagcattggtgacatcaac
caggatggattccaggacattgctgtgggagctccatttgagggcttgggcaaagtatac
atctaccacagcagctccggggggctcctcaagcagcctcagcagataatccacggagag
acactaggactgcctggcttggccaccttcggctactctctgagtgggaagatggatgtg
gatgaaaacttatacccagacctgctagtagggagcctgtcggaccacattgtgctgctg
cgggcccgacctgtcatcaatatcctccacaggaccttggtggccaggccagctgtgttg
gacccctcgctttgtacggttacttcctgtgttcaggtggagctgtgctttgcctacaac
cagagtgccgggaaccccaactacaggcggaacatcaccctggcttacacagtggaggct
gacagggaccgacgcccacccaggctccgattcgcccgtagccagtcgtcggtcttccat
ggcttcttctccatgccagagacacattgccagacattggagttactgctgatggacaat
gttcgtgataaactccgtcctatcgtcatcaccatgaactactccttacctttgcgcatg
cccgatcgcctcaagctgggcttacggtccctggatgcctacccggtcctcaaccaggca
caggctatggagaatcacaccgaggtccacttccagaaagagtgcgggccagacaacaag
tgcgacagcaacctgcagatgcgagccgccttcgtgtctgagcagctgcagcctctaagc
aggctccagtacagcagagacactaagaaactgttcttgagcatcaatgtgaccaattcg
ccgagccgccaacgggctggggaagatgcccatgaggcactgctcactctagaggtgtca
tccgctctgcttctgtcctccgtgcgcccggctgggacctgccaagctaacgagaccaac
accgtgtgtgagctaggaaaccccttcaaacggaaccagaggatggagctgctcatcgcc
tttgaggtcaccggggtaactttgcacacgagggaccttagggcacatctacagctgtcc
acgtcaagtcaccaggacaacttgcagcccatgttcctgactttgcaggtggactacacc
ctccaggcctcgctcagtttgatgaatcatcgactgcagagcttctttagtgggacagtg
atgggcgaggctgccatgaagactgtgaaggatgtgggaagccccctgaaatatgaattc
caggtgagcccagtgggagacgggctggcagccttgggcacactggttctaggtctggag
tggccgtatgaagttaccaatggcaagtggctgctgtaccctacggagatcaccatccac
agcaatgggtcctggccctgccagccacatggaaaccttgtcaaccctctcaaccttact
ctctctgaccctggagtcaagccactgtccccacagcgccggcggagacaactagatcca
gggggagaccagggtcctccacctgtcacgctagctgctgccaaaaaagccaagtctgag
accgtgttgacctgttccaatggccgcgcccgctgtgtgtggctggagtgcccccttcca
gatgcctccaacattaccaatgtgaccgtgaaggcacgggtgtggaacagcaccttcatt
gaggactacaaagactttgacagagtccgagtagatggctgggctaccctgttcctgaga
accagtatccctaccatcaacatggagaataagaccacatggttctccgtggacatcgac
tctgagctggtggaggagctgcccgctgagatcgagctgtggttggtgcttgtggccgtg
ggtgctgggttgctgctactgggcctcatcatcatcctgctgtggaagtgcggcttcttc
aagcgagcccgcactcgtgccctgtatgaagctaagagacagaaggctgagatgaggagc
cagccatcagagacagaaaggctgaccgacgactactga

DBGET integrated database retrieval system