KEGG   Rattus norvegicus (rat): 360613Help
Entry
360613            CDS       T01003                                 

Gene name
Cwc25, Ccdc49, RGD1305258
Definition
(RefSeq) CWC25 spliceosome-associated protein homolog
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: CWC25 Cir_N
Motif
Other DBs
NCBI-GeneID: 360613
NCBI-ProteinID: NP_001101765
RGD: 1305258
Ensembl: ENSRNOG00000004091
UniProt: G3V6I3
Position
10q31
AA seq 415 aa AA seqDB search
MGGGDLNLKKSWHPQTLRNVEKVWKAEQKHEAERKKIEELQRELREERAREEMQRYAEDV
GAVKKKEEKLDWMYQGPGGMVSRDEYLLGRPIDKYVFEKMEEREAGCSSETGLLPGSIFA
PSGANSLLDMASKIREDPLFIIRKKEEEKKREVLNNPVKMRKIKELLQMSLEKKEKKKKK
EKKKKHRKHKHRSSSSDRSSSEDEQSHGRSQKKMANSFPVLSKVPGYGLQVRDSDRNQGL
QGSLGEQRAVKNHSRSSSSPARHASRKSTKEERSRDRRSRSPGRKSLSPRPSKQHTSKAN
RKERDSPSPKKEVYQRRHASGYTRKLSAEELERKRQEMMENAKWREEERLNTLKRHAKED
EQEHRLERLDSRSGKFIHRMKLESASTSSLEDRVKRNIHSLQRTSMALEKNFMRR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcggagacctgaacctgaagaagagctggcacccgcagacccttcgcaatgtg
gagaaagtgtggaaggcggagcagaaacatgaagcggagaggaaaaagattgaggagttg
cagcgagagcttcgagaggagcgagctcgggaggagatgcagcgctacgctgaggatgtc
ggggctgtcaagaaaaaagaagaaaagttggattggatgtaccaaggcccaggtggcatg
gtgagccgcgatgagtacctgctggggcgccccattgacaagtatgtttttgagaagatg
gaggagagggaggccggctgctcttctgagacaggactcctcccaggctcaatcttcgcc
ccgtcgggtgctaattctcttcttgacatggccagcaaaatccgggaagaccctctcttc
atcataaggaagaaagaggaggagaaaaaaagagaagtactgaacaaccctgtgaaaatg
aggaaaatcaaagagctgttgcaaatgagtcttgaaaaaaaagagaagaagaagaagaag
gagaagaagaagaagcacaggaaacacaaacacagaagctcaagcagcgatcgctccagc
agcgaggatgagcagagccatggccgatctcaaaagaagatggcaaattcctttcctgtt
ttgtccaaagtccctggatatggcttacaggtgagggactctgaccggaaccaggggctg
caggggtctctgggtgaacaaagggcagtaaagaaccattcccggtcaagctcctccccc
gccaggcatgccagcaggaaaagcaccaaggaagagagatcccgggacaggaggtctcga
tcccccggcagaaagtcactgtccccaaggcccagcaaacagcacacctctaaggcaaac
aggaaggagagagacagcccgtcacctaaaaaggaggtctaccagcggcggcatgcttct
gggtacaccagaaaactctcagcggaggaactagagcggaaacggcaggagatgatggaa
aatgccaagtggagggaggaagagaggctcaacaccctcaagaggcacgccaaggaagat
gagcaggagcacaggctggagaggttggactctcggtccggcaagttcatccaccgcatg
aagctggagagcgcgtccacctcttccctggaggaccgggtcaagcgcaacatccattct
ctgcagcggacatcgatggctctggagaagaacttcatgagaagatga

DBGET integrated database retrieval system