KEGG   Rattus norvegicus (rat): 360616Help
Entry
360616            CDS       T01003                                 

Gene name
Ppp1r1b, Darpp-32, Darpp32
Definition
(RefSeq) protein phosphatase 1, regulatory (inhibitor) subunit 1B
  KO
K15494  protein phosphatase 1 regulatory subunit 1B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04728  Dopaminergic synapse
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    360616 (Ppp1r1b)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    360616 (Ppp1r1b)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    360616 (Ppp1r1b)
   05031 Amphetamine addiction
    360616 (Ppp1r1b)
   05034 Alcoholism
    360616 (Ppp1r1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    360616 (Ppp1r1b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     360616 (Ppp1r1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DARPP-32 Cwf_Cwc_15 Nop14
Motif
Other DBs
NCBI-GeneID: 360616
NCBI-ProteinID: NP_612530
RGD: 621859
Ensembl: ENSRNOG00000028404
UniProt: Q6J4I0
Position
10q31
AA seq 205 aa AA seqDB search
MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPALLFRVSEHSSPEEESSPHQRTSGE
GHHPKSKRPNPCAYTPPSLKAVQRIAESHLQTISNLSENQASEEEDELGELRELGYPQED
DEEDEDEDEEEDEEEDSQAEVLKGSRGTAGQKLTSGQGLEGPWERPPPLDEPQRDGNSED
QGEGRATQSEPGEEPRHPTPPESGT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggaccccaaggaccgcaagaagatccagttctctgtgcccgcgcccccgagccagctc
gacccccgacaggtggagatgatccggcgccggaggccaacccctgccttgctgttccgg
gtctcagagcattcctcgccagaggaggagtcctctccgcaccagagaacctcaggagag
gggcaccacccaaagtcgaagagacccaacccctgtgcctacactcccccatcactgaaa
gctgtgcaacgcatcgctgagtcccacctgcagaccatcagcaacctgagtgagaaccag
gcctcggaggaagaggacgagttaggggagcttcgggagctggggtatccacaagaggat
gatgaagaggatgaggacgaggatgaagaggaggacgaagaagaagacagccaggcggag
gtcctgaaaggcagcagggggactgcggggcagaagcttacttctggccagggtctggag
gggccctgggagcgcccacctcctctggatgagccccagagagatggaaactctgaggac
caaggggaaggcagagcaacacaaagtgagccgggagaggagcctcggcaccctaccccc
cctgagtccggcacataa

DBGET integrated database retrieval system