KEGG   Rattus norvegicus (rat): 360623Help
Entry
360623            CDS       T01003                                 

Gene name
Krt28, Ka41, Krt25d
Definition
(RefSeq) keratin 28
  KO
K07604  type I keratin, acidic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04915  Estrogen signaling pathway
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    360623 (Krt28)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    360623 (Krt28)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     360623 (Krt28)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   360623 (Krt28)
  Exosomal proteins of other body fluids (saliva and urine)
   360623 (Krt28)
  Exosomal proteins of colorectal cancer cells
   360623 (Krt28)
  Exosomal proteins of melanoma cells
   360623 (Krt28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament DUF148 TPR_MLP1_2 SPATA1_C
Motif
Other DBs
NCBI-GeneID: 360623
NCBI-ProteinID: NP_001008760
RGD: 1309530
Ensembl: ENSRNOG00000011846
Vega: OTTRNOG00000001545
UniProt: Q6IFW7
Position
10q31
AA seq 383 aa AA seqDB search
MSLRFSGGSRHAGLQSGSLRPPSGGAGFAGSSAAGGSVAGSGFSWALGGTLCSAPGGSHA
TGALGNVTCVGFAGSEGGLLSGNEKVTMQNLNNRLASYLDNVKALEEANTELERKIKTWH
EKYGPGSCRGLDRDYSNYHLTIEDLKSKVISSTAANANIILQIDNARLAADDFRLKYENE
LTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKVLQCAAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFQEKSATLQQQISNDLGAATSA
RTELTELKRSLQTLEIELQSLSATGFESGTSGNSSKDVSKTTLVKTVVEEIDPRGKVLSS
RIHSIEEKMTKISNSKAEQRVPF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccggttttctggcggatccaggcacgctggcctacagtcaggatccctcagg
ccgcccagcggaggcgcaggctttgctgggagcagtgcggccggcggttcagttgctggt
agtggattttcttgggccttgggagggacactgtgcagtgctcctggtgggagccacgct
actggtgccctgggaaatgtcacttgtgttggcttcgctggaagtgaaggagggctcctc
tctggaaacgagaaggtcaccatgcagaatctcaacaaccgcttggcctcttacctggat
aatgtgaaagctctggaggaagcgaacactgaactagagagaaagatcaaaacttggcat
gagaaatacggacccggatcttgccgtgggcttgaccgtgactacagcaattatcatcta
accattgaggaccttaaaagcaaggtcatctcttccacggctgctaacgctaatataatt
ctgcagattgataatgccagactggctgctgacgatttcagactaaagtatgaaaacgaa
ctcacccttcaccaaaatgtggaggccgacatcaatggattgcgtcgcgtcctggacgag
ctgacgctctgcaggacggaccaagagctgcagtatgaatccctgagtgaggagatgact
tacctcaagaagaaccacgaagaggaaatgaaggttctgcagtgcgcagccggaggtaac
gtgaatgtggagatgaacgcggccccgggcgtggacctcaccgtcctgctgaacaacatg
agagccgagtacgaggccctggctgagcagaaccgcagggacgccgaggcctggttccaa
gagaagagcgccacgctgcagcagcagatctccaatgacttgggcgcagccacctcagcc
aggactgagctgacagagctgaagcgctccctgcagacgctggagatcgagctgcagtca
ctctcagcaacgggttttgaatctggaacctcggggaattcatccaaagatgtatccaaa
accacactggtgaagaccgtggttgaagaaatagatccgcgtggtaaggtcctgtcctcc
aggatccactccatcgaggaaaagatgaccaagataagcaacagcaaggctgagcagagg
gttcccttctag

DBGET integrated database retrieval system