KEGG   Rattus norvegicus (rat): 360630
Entry
360630            CDS       T01003                                 

Gene name
Naglu
Definition
(RefSeq) alpha-N-acetylglucosaminidase isoform X1
  KO
K01205  alpha-N-acetylglucosaminidase [EC:3.2.1.50]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    360630 (Naglu)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    360630 (Naglu)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    360630 (Naglu)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.50  alpha-N-acetylglucosaminidase
     360630 (Naglu)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   360630 (Naglu)
SSDB
Motif
Pfam: NAGLU NAGLU_C NAGLU_N
Other DBs
NCBI-GeneID: 360630
NCBI-ProteinID: XP_002727861
RGD: 1564228
Ensembl: ENSRNOG00000032381
UniProt: D3ZZL3
Position
10
AA seq 739 aa
MGAAGLAAILGFLLLARDLVGDEAQEAEAVRELVVRLLGPGPAADFLVSVERALANESGL
DTYSLSGGGGVPVLVRGSSGVAAAAGLHRYLRDFCGCHIAWSSSQLHLPSPLPAVPDGLT
EATPNRYRYYQNVCTHSYSFVWWDWARWEQEIDWMALNGINLALAWNGQEAIWQRVYLAL
GLTQSEIDNYFTGPAFLAWGRMGNLHTWDGPLPRSWHLKQLYLQHRILDRMRSFGMTPVL
PAFAGHVPKAITRVFPQVNVIQLGNWGHFNCSYSCSFLLAPGDPLFPLIGTLFLRELTKE
FGTDHIYGADTFNEMQPPFSDPSYLAAATAAVYEAMVTVDPDAVWLLQGWLFQHQPQFWG
PSQIKAVLEAVPRGRLLVLDLFAETQPVYSRTASFHGQPFIWCMLHNFGGNHGLFGALED
VNQGPQAARLFPNSTMVGTGIAPEGIGQNEVVYALMAELGWRKDPVPDLVAWVSSFASRR
YGVSQPDAVAAWRLLLRSVYNCSGEACSGHNRSPLVKRPSLQMSTAVWYNRSDVFEAWRL
LLRAAPNLTASPAFRYDLLDVTRQAVQELVSSCYEEARTAFLNQDLDLLLRAGGLLTYKL
LPSLDELLASNSHFLLGTWLDQAREVAVSESEAQFYEQNSRYQITLWGPEGNILDYANKQ
LAGLVADYYQPRWCLFLGTLAHSLARGIPFQQHQFEKSVFPLEQAFINNKKRYPIQPQGD
TVDLSKKIFLKFHPQPDSL
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgggagccgcggggctggcggcgattctggggttcttactcctggcccgggacttggtg
ggtgatgaggctcaggaggcagaggctgtacgggagctggtggtccggctactgggaccc
gggccggcggccgatttcttggtgtccgtggagcgcgcgctggcgaacgagtcgggcctg
gacacctacagtctgagcggaggtggaggggtgccagtgcttgtgcgtggctcctcgggc
gtggcggccgccgcggggctgcaccgctacctgcgtgacttctgtggctgtcacatagcc
tggtccagctctcagctgcacctgccgtcgccgctgcctgcagtgccggatgggctgacc
gaagccacgcccaacaggtaccgctattaccagaatgtgtgcacgcacagctactccttc
gtgtggtgggactgggcccgttgggagcaagagattgactggatggcgctgaatggcatc
aacctggcactagcttggaatggccaggaggccatctggcaacgggtatacctggccttg
ggcctgacccagtcagagatcgataactacttcaccggtcctgccttcctggcctgggga
cgcatgggtaacctgcacacctgggatggccccctgccccgttcctggcacctcaagcaa
ctctacctgcagcaccgaatcctggaccggatgcgctcctttggcatgaccccagtgctg
cctgccttcgcagggcatgtccccaaggccatcaccagggtgttcccacaggtcaatgtc
atccagttggggaactggggacatttcaactgctcctacagctgctccttccttttggct
ccaggagaccccctgttccccctcattgggaccctcttcctacgggagctgaccaaagag
ttcggcacggatcacatctacggggctgacaccttcaatgagatgcagcctcccttctcc
gatccctcctacctcgccgcagccaccgcagctgtctatgaagccatggtcactgtggac
cctgatgctgtatggctgctccaaggctggctcttccagcaccagccccagttctggggc
ccctctcaaatcaaggctgtgctggaggccgtgccccgtggtcgtctcctggttctagac
ctgttcgctgagacccagcctgtttacagccgcacagcctccttccatggccagcccttc
atctggtgcatgctccacaactttgggggcaaccatggcctgttcggagccctcgaggat
gtgaaccagggtccccaggcagcccgcctcttccccaactccaccatggtcggcactggc
atagcccctgagggcattggccagaatgaagtggtctatgctctcatggctgagctgggc
tggcgcaaggatcctgtgccggatttggtagcctgggtgagcagttttgccagccgccgg
tacggggtctcccagccggatgcagtggcagcctggaggctcctactcaggagtgtctac
aactgctctggggaggcgtgcagcgggcacaatcgaagcccactggtcaagcggccatcc
ctacagatgagtaccgctgtctggtacaacagatcagatgtgtttgaggcttggcgactg
ctgttaagagctgctccaaacctgaccgccagcccagccttccgctacgacctgctggat
gtcacccgtcaagcggtgcaggagctggtcagctcgtgctatgaggaggcaaggaccgcc
ttcctgaatcaggatcttgatctcctgctcagggctggaggcctcctgacctataagctt
ctgccttcactagatgaactgctggctagcaacagccacttcttgctggggacctggtta
gatcaggcccgggaagtggctgtgagtgagtctgaggcccagttctatgaacaaaacagc
cgctaccagattaccctttgggggcctgagggtaacattttggactatgccaataagcaa
ctggcaggactggtggctgattactaccagccacgttggtgtctcttcttggggaccctg
gctcacagcctagccagagggatccccttccaacagcaccagtttgagaagagtgttttc
ccactagagcaggctttcattaacaacaagaagaggtatcccattcagccccaaggggat
actgtggacctctccaagaagatcttcctcaaatttcacccccagcctgactctttgtga

DBGET integrated database retrieval system