KEGG   Rattus norvegicus (rat): 360632
Entry
360632            CDS       T01003                                 

Gene name
Fam134c, RGD1561189
Definition
(RefSeq) family with sequence similarity 134, member C
  KO
K23880  reticulophagy regulator
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360632 (Fam134c)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    360632 (Fam134c)
SSDB
Motif
Pfam: Reticulon Cadherin_C_2
Other DBs
NCBI-GeneID: 360632
NCBI-ProteinID: NP_001129276
RGD: 1561189
Ensembl: ENSRNOG00000020056
UniProt: B2GV94
Position
10q31
AA seq 466 aa
MEEAEGVAAAPGPSSGLAFRGRRAMSGSWERDQQVEAAQRALVEVLGPYEPLLSRVQAAL
VWERPARSALWCLGLNAAFWFFALTSLRFVFLLAFSLMIIVCIDQWKNKIWPEINVPRPD
ALDNESWGFVHPRLLSVPELCHHVAEVWVSGTIFIRNLLLFKKQNPGKFCLLSCGILTFL
AMLGRYVPGLLLSYLMLVIIIMWPLAVYHRLWDRAYVRLKPALQRLDFSVRGYMMSKQRE
RQLRRRALHSEHAVDTHSDSEEELAAFCPQLDDSTVARELAITDSEHSDAEVSCTENGTF
NLSRGQTPLTEGSEDLDGHSDPEESFARDLPDFPSINVDPAGLDDEDDTSIGMPSLMYRS
PPGTGDTQGLPASRNEAALPELLLSSLPGGSNLTSNLASLVSQGMIQLALSEASQTDPSG
PPPRRAARGFLRAPSSDLDTDAEGDDFELLDQSELNQLDPASSRSH
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggaggaggctgaaggggtggccgcggccccgggtccatcttcggggttggctttcagg
ggccgccgagctatgtccggctcctgggagcgcgaccagcaggttgaggcggcgcagcga
gccctggtagaggtgctggggccttacgagcctctgctgagccgggttcaggcagccctg
gtgtgggagcggccggccaggagcgccctgtggtgcctggggctgaacgcggcgttctgg
ttttttgcactgacatcccttcgttttgtatttttacttgcattcagcttgatgatcatt
gtctgtattgaccaatggaagaacaaaatttggcctgagataaacgtgccgagacctgac
gcgttggacaatgagagttggggctttgtgcaccctcggttgctcagcgtgcccgagctc
tgccaccatgtagctgaagtctgggttagtgggaccattttcataaggaatcttttgctt
ttcaaaaagcaaaacccaggcaagttctgcctgctaagctgtgggatactgacttttttg
gccatgttgggccgctacgtccctgggctcctgctgtcctacttgatgcttgtcatcatt
attatgtggcctcttgctgtctatcaccgactatgggatcgagcctatgtgcgactgaag
ccagctctgcagcggctggacttcagtgtccgtggctacatgatgtccaagcagagagaa
agacaattgcgccgcagagctctgcactcagagcatgccgtggacacccacagtgacagt
gaagaggaacttgcggccttctgtcctcagctggatgattctactgttgccagggaattg
gctatcacagattcggagcactctgacgctgaggtctcctgtacagaaaatggcacattc
aacctgtcaaggggccaaacacctctaacagaaggctctgaagacctagatggtcacagt
gatccagaggaatcatttgccagagaccttccagacttcccttccattaatgtggaccct
gctggcctggatgatgaggacgacaccagcattggaatgcccagcttgatgtaccgctcc
ccaccaggaactggggatacccagggcctgcctgctagtcggaatgaggctgcactgcca
gagctcctgcttagttcccttcctggaggatctaaccttaccagcaaccttgccagcctg
gtctcccaggggatgattcaactggccttgtcagaggcctcccagacagacccttctggc
ccacctccccgaagagcagcaagaggcttcctccgggcccctagttcagacctggacact
gatgctgaaggagatgattttgaacttctggaccaatcagagctgaatcagctagaccct
gccagttctaggagccactga

DBGET integrated database retrieval system