KEGG   Rattus norvegicus (rat): 360639
Entry
360639            CDS       T01003                                 

Gene name
Dcakd
Definition
(RefSeq) dephospho-CoA kinase domain containing
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: CoaE AAA_18 AAA_33
Other DBs
NCBI-GeneID: 360639
NCBI-ProteinID: NP_001007725
RGD: 1359211
Ensembl: ENSRNOG00000021682
UniProt: Q6AY55
Position
10q32.1
AA seq 240 aa
MFLVGLTGGIASGKSSVIQVFQQLGCAVIDVDVIARHIVQPGCPAHRRIVEAFGTEVLLE
NGDINRKVLGDLIFNQPDRRQLLNSITHPEIRKEMMKETFKYFLRGYRYVILDIPLLFET
KKLLKYMKHTVVVYCDRDTQLARLMKRNNLNREDAEARINSQLPLKDKARMANHVLDNSG
EWSLTRRQVILLHAKLERSMEYLPLRLGFLTGLAGIASLLYLLTRYLLPSPQLGNPGSKP
NT seq 723 nt   +upstreamnt  +downstreamnt
atgttcctggtgggcctaactggaggcatcgcctcaggcaagagctcagtcatccaggtg
ttccagcagctgggctgtgctgtgattgacgtggacgtcattgcccggcacattgtccag
ccagggtgtcctgcccaccggcgtatagtagaggcctttggcactgaagtcttgctggag
aatggggacatcaaccgcaaggtcctcggagacctgatcttcaaccagcctgaccgtcgg
cagctgcttaactccatcacccaccctgagatccgcaaggaaatgatgaaagagaccttc
aagtacttcctccgagggtaccgatacgtgattctggacatccccctcctgtttgagacc
aagaagctgctcaagtacatgaagcacacagtggtagtgtactgtgaccgcgatacacag
ctggcgcgactgatgaagcggaacaacctgaaccgggaggacgcagaggcgaggatcaat
tcccagctacccctgaaggacaaggcccgcatggccaaccacgttctagacaactcggga
gagtggagcctcaccagacgccaggtcatcctcctgcatgccaagctggaacgctccatg
gagtacctgccactgaggctcgggttcctaacgggcctcgcaggcatcgccagcctcctc
tacctgctcacccgttaccttctcccttccccccagctgggtaaccccggcagcaagcct
tag

DBGET integrated database retrieval system