KEGG   Rattus norvegicus (rat): 360643Help
Entry
360643            CDS       T01003                                 

Gene name
Cdc27
Definition
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    360643 (Cdc27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    360643 (Cdc27)
   04114 Oocyte meiosis
    360643 (Cdc27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    360643 (Cdc27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    360643 (Cdc27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    360643 (Cdc27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    360643 (Cdc27)
   03036 Chromosome and associated proteins [BR:rno03036]
    360643 (Cdc27)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     360643 (Cdc27)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     360643 (Cdc27)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    360643 (Cdc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_17 TPR_16 TPR_19 TPR_14 TPR_6 TPR_9 ChAPs TPR_MalT TPR_20 TPR_21 Cas_Cas02710
Motif
Other DBs
NCBI-GeneID: 360643
NCBI-ProteinID: NP_001019964
RGD: 1304921
Ensembl: ENSRNOG00000005904
UniProt: Q4V8A2
Position
10q32.1
AA seq 824 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDLVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTALVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDNVPLGTGPSILSKQVQNKPKTGRSLLGGPTALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVPSTGAPTKKSVARMGHTGAKSVFSQSGNSREATPVLVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYSTGWVLCQIGRAYFELSEYMQAERIFSEVRRIESFRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacctgtccaggctgctatatggcaagcactaaaccactatgct
taccgagacgcagttttcctcgcagaacgactatatgcagaagtacattcagaagaagcc
ttgtttctactggcgacctgttactaccgctcaggaaaggcctataaagcctatagactc
ttgaaaggacacagttgtaccaccccgcagtgtaaatacctgcttgcaaaatgttgtgtt
gacctcagcaagcttgcagaaggggaacaaatcttatctggtggagtgtttaataagcaa
aaaagccatgacgaccttgtcactgagtttggtgattcagcttgcttcactctttccttg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcgttatgtgaaataggtgag
aagccagatcctgaccaaacatttaaattaacatctctacagaattttagcagttgtctt
cccaacacgtgtacagctctagtatctaaccacagtttatctcacagacagcctgagaca
gtccttacagaaactccccaagacacgattgaattaaacagactgaacttagaatcttcc
aattcaaagtactccttgaatacagattcctccgtgtcttacattgattcagctgtaatt
tcaccagataacgtcccccttggaactggtccttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccaactgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgacgtgccatccaccggagcacctactaaaaagtcc
gttgcaagaatgggccacactggagcgaagtctgtcttctcacagagtgggaacagtcgg
gaggccacaccggtgctcgttgcccagacacaaagctctggcccacaaacaagtacaaca
cctcaggtattgagccccactattacatctcccccaaatgcattgcctcgaagaagttcc
cgccttttcactagtgacagttctacaaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataact
caacccaacataaacgatagtctggaaattacaaaattggactcttctatcatttcagaa
gggaaaatatccacaatcacacctcagatccaggcatttaacctacaaaaggcagcagca
ggtttgatgagccttcttcgtgaaatgggaaaaggttatttagctttgtgttcatacaac
tgcaaagaagctataaatattctgagccacctaccttctcaccactacagtactggctgg
gtcctgtgccagattggacgggcttattttgaactttcagaatacatgcaggctgaaaga
atattctcagaagttagaaggattgagagtttcagagttgagggtatggagatctactct
acaacactctggcatcttcagaaagatgttgctctttcggttctttcaaaagatttaaca
gacatggataagaattcaccagaggcttggtgtgctgcagggaattgtttcagtctacaa
cgggagcatgatatagcaattaaattcttccaaagagctatccaggtggatccaaattat
gcttatgcctatactctattaggacatgaatttgtgttaactgaagaactagataaagca
ttagcatgttttcgaaatgctataagagtaaatcccagacattataatgcatggtatggt
ttagggatgatttattacaagcaagagaaattcagcctcgcagaaatgcatttccagaaa
gcacttgatatcaaccctcagagttcagttttactttgccacattggagtagttcagcat
gcactcaagaagtctgagaaggctttggataccctaaacaaagccattgttatagatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatacaag
tctgctttacaagaacttgaagaactgaaacagattgtccccaaagaatccctcgtttac
ttcttaataggaaaggtttacaagaagttgggtcaaactcatctcgccttgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataatcagattaaagaggcaattgac
aagcgctaccttccagatgatgaggagccgataacccaggaggagcagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcagatgacactcaacttcatgcagcggaa
agtgatgaattttaa

DBGET integrated database retrieval system