KEGG   Rattus norvegicus (rat): 360647Help
Entry
360647            CDS       T01003                                 

Gene name
Icam2
Definition
(RefSeq) intercellular adhesion molecule 2
  KO
K06523  intercellular adhesion molecule 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    360647 (Icam2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    360647 (Icam2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    360647 (Icam2)
   04091 Lectins [BR:rno04091]
    360647 (Icam2)
CD molecules [BR:rno04090]
 Proteins
  360647 (Icam2)
Lectins [BR:rno04091]
 I-type lectins (Siglecs)
  360647 (Icam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICAM_N Ig_2 Adhes-Ig_like
Motif
Other DBs
NCBI-GeneID: 360647
NCBI-ProteinID: NP_001007726
RGD: 1359660
Ensembl: ENSRNOG00000025143
UniProt: Q6AXM6
Position
10q32.1
AA seq 277 aa AA seqDB search
MSSFACWNLSLTLLVLFCSPGSGEKAFEVYIRSEKQIVKATEAWRVNCSTSCAAPEIGGL
ETPTNKLMLEEDPHGKWIEFLVSNATVDTVLLCHFTCSGKQQAESFNIRVYEPPAQVTLK
LQPPRVFMGEAFTIECKVPSVKPLESLTLSLLCGRETLKNQTFGGAETVPEEVIAIFNST
ALKKDGLNFSCQAELDLRPHGGSLYRRISEYQSLEVYEIRQDNQMVIIIVVVSILLFLFV
TSVLLCFILGQHWHRRRTGTYGVLAAWRRLPRALRGR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttttgcttgctggaacctgtctctaacccttcttgtcctgttctgcagccca
gggtctggtgaaaaggcctttgaagtctacatacggtccgagaagcagatagtaaaagcc
acagaggcttggagagtcaactgcagcaccagctgtgcagccccagagatcggtggtctg
gagacccctacgaataagttaatgttggaagaggaccctcatgggaaatggatagaattc
ctagtctcaaacgccactgtcgacacggtcttactttgccatttcacttgttcgggaaag
cagcaggcagagagtttcaacatcagggtgtatgagcctccagctcaggtaacactgaaa
ctgcagccccctcgagtgtttatgggtgaagccttcaccattgaatgcaaggtgccctct
gtgaagccccttgagagcctcaccctctctctgctctgtggcagagagaccctgaagaac
cagacatttgggggagctgaaactgtcccagaagaggtcatagccatattcaacagcaca
gctctgaaaaaggatggtcttaacttttcctgccaggctgagctggatctacgaccccac
ggtgggtctctctaccgccgcatctcagagtaccagagccttgaagtctatgaaataagg
caagacaaccagatggtcatcatcattgtagtggtgtcaatacttctgttcttattcgtg
acatccgtcctgctttgctttatcctcggccagcactggcacaggaggcggacaggtacc
tacggggtgctagctgcctggaggaggctcccccgagccctccggggacgctga

DBGET integrated database retrieval system